KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276302
Entry
107276302         CDS       T01015                                 
Name
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1-like
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107276302
   01040 Biosynthesis of unsaturated fatty acids
    107276302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    107276302
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     107276302
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     107276302
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   107276302
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 107276302
NCBI-ProteinID: XP_015642771
LinkDB
Position
6:complement(11178994..11181404)
AA seq 325 aa
MAMPIWLILLASLGAVHVAADVLRLVATLTFGLRARPRGDLRRRYGSWAVVTGPTSGIGR
AMALELAGRGLNVVLVGRDPAKLRDVAGAIARSHSHHGVRTKTVVFDFSLVSTVQGEKAM
AALRETVEGLDVGVVVNNAGVAKPGAMFLHEVEVEPLMRMIRVNMLALTKVTAAVLPGMV
MRGRGAVVNIGSASAEALPSFPLYSVYAGTKAYVGEFSRGLSVEYKRKGIDVQCQVPCLV
ETNMISRAMKDIFLSQFVVTPEEYARAAVRSIGHGRMCVPNMAHRVQLLGMRSTPDFVLN
WYRLRLHLQQRAIFRSRRCHRIALL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggccatgccgatatggctcatcctgctggcctccctcggcgccgtccatgtcgccgcc
gacgtcctccgactcgtcgccaccctcacgttcggcctgcgcgcccgtcccaggggggac
ctccgccgccggtacggctcgtgggccgtcgtcaccgggccgacgtcaggcatcggccgt
gccatggcgctggagctcgcggggcgcggcctcaacgtcgtcctcgtcggccgtgacccc
gccaagctccgcgacgtcgccggcgccatcgcccggtcccactcccaccacggcgtgcgc
accaagaccgtggtcttcgacttctccctcgtctccaccgtgcaaggtgagaaggcgatg
gcggcgctaagggagacggtggaggggctggacgttggggtggtggtgaacaatgccggc
gtggcaaagcccggcgcgatgttcctgcatgaggtggaggtggagccattaatgaggatg
atacgggtgaacatgctagccctaacgaaggtgacggcggcggtgctgccggggatggtg
atgaggggcaggggtgctgtcgtcaacatcggctcggcgtcagcggaggctctcccctcc
ttcccgctctactccgtctacgccggcaccaaagcatatgttggtgagttctcaagaggc
ctctccgtggagtacaagagaaagggaatcgatgtgcaatgccaggtgccatgcctggtg
gagacgaacatgatatcgagagccatgaaggatatctttctgtcgcagttcgtggtgacc
ccggaggagtacgcccgtgcggcggtgcggtcgatcggccacgggcggatgtgcgtgccc
aacatggcgcaccgagtgcagctcctggggatgagatccaccccggatttcgtgttgaac
tggtaccgcctgcggctccacttgcagcagcgagccatctttcgaagccgcaggtgtcat
cggatcgcgctcctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329873
Entry
4329873           CDS       T01015                                 
Name
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4329873
   01040 Biosynthesis of unsaturated fatty acids
    4329873
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4329873
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     4329873
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     4329873
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4329873
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 4329873
NCBI-ProteinID: XP_015626287
LinkDB
Position
2:complement(23241643..23244644)
AA seq 325 aa
MAGTCAHAEFFRAQPAWALALAGVGLLAAARAALRLALWLYAAFLRPGKPLRRRYGAWAV
VTGATDGIGRAMAFRLAASGLGLVLVGRSPDKLASVSEEIRGRYPRVEVRTFVLDFAADG
LAAGVEGLREAIRGLEVGVLVNNAGVSYPYARYLHEVDEELMRTLIRVNVEGLTRVTHAV
LPAMVERKRGAIVNIGSGSSSVMPSDPLYSVYAATKAYVDQFSRCLYVEYKSKGIDVQCQ
VPLYVATKMASIRKSSFFVPSADTYARAAIRHIGYEPRCTPYWPHSVMWFLISILPESLI
DSIRLGMCIKIRKKGQAKDAKKKAQ
NT seq 978 nt   +upstreamnt  +downstreamnt
atggccggcacgtgcgcgcacgccgagttcttccgcgcgcagccggcgtgggcgctggcg
ctggcgggcgtcggcctcctcgccgccgcccgcgccgcgctccgcctcgcgctctggctc
tacgccgcgttcctccgcccggggaagcccctgcgccgccgctacggcgcctgggcggtc
gtcacgggcgccaccgacggcatcggccgcgccatggcgttccgcctcgccgcctcgggg
ctcggcctcgtcctcgtcggccggagccccgacaagctggcctcggtctccgaggagatc
agggggaggtaccccagggtggaggtgcggacgttcgtgctcgacttcgccgccgacggc
ctcgccgccggggtggaggggctcagggaggccatccgtgggctcgaggtgggcgtgctc
gtcaacaacgccggtgtctcgtacccgtacgcccgctacctccacgaggtggacgaggag
ctcatgcgcaccctgatccgggtcaacgtcgagggcctcacgcgggtcacgcacgccgtg
ctcccggccatggtggagaggaagcgcggcgccatcgtcaacatcggctccggctcctcc
tccgtcatgccgtccgatccgctctactccgtctacgccgccaccaaagcttacgttgac
caattctcaagatgcctttatgttgagtacaagagcaagggtattgatgtgcaatgccag
gtgcccttgtatgtggcaacaaagatggcctctatcaggaaatcctcgttctttgtccca
tccgcggacacctacgcccgtgctgccattcgtcacataggctatgagccgaggtgcaca
ccgtactggccacactctgtaatgtggttcctgatctccattctccccgagtcactcatt
gacagcattcgcctgggaatgtgcatcaagatccgcaagaaggggcaagccaaagatgct
aagaagaaagcgcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334949
Entry
4334949           CDS       T01015                                 
Name
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4334949
   01040 Biosynthesis of unsaturated fatty acids
    4334949
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4334949
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     4334949
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     4334949
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4334949
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3HCDH_N
Other DBs
NCBI-GeneID: 4334949
NCBI-ProteinID: XP_015634220
UniProt: A0A0P0W666 Q7XT17
LinkDB
Position
4:984531..986843
AA seq 319 aa
MATGAAPLWFTSLAGLGAAYLTVVFLRLLPYLALYLRRPKDLRRCYGEWAVVTGPTTGLG
RSMAMELARRGFNLVLLDLDRDNLREVSEAIREAHAGAVATRTVVFDLSTVGTGAGEEGM
RRLREAVDGVEVGMLVNNAAVARPGALYFHEADVERLVAMIRVNAMALTAVTAAVLPAMA
RRGRGAIVNVGSGSTVAVPSFPLYTVYSSTKRYVEQLSKSLYVEYKGKGIDVQLQVPFYV
HTNMLSAAIKDRMLLPAFVATADDYTRAAARWVGHGHIAVPDAGQQLQWFLAAFVPDFAH
DWYRLRKHLQHRAILWNLI
NT seq 960 nt   +upstreamnt  +downstreamnt
atggctacgggggcggcgccgctctggttcacctcgctggccggcctcggcgccgcctac
ctcaccgtcgtcttcctccgcctcctcccttacctcgccctctacctccgccggcccaag
gacctccgccgctgctacggcgagtgggccgtggtcaccggcccgacgacggggctcggg
cgatccatggccatggagctcgcccgccgcggcttcaacctcgtcctcctcgacctcgat
cgggataacctccgcgaggtgtcggaggcgattcgcgaggcccacgccggcgcggtggcc
accaggacggtggtgttcgacctgtcgaccgtcggcaccggcgccggcgaggaggggatg
cggcggctgagggaggcggtggacggggtggaggtcgggatgctggtgaacaacgccgcc
gtggcgaggcccggggcgctctactttcacgaggccgacgtggagcggctggtggcgatg
atacgggtgaacgccatggcgctgacggcggtgaccgccgccgtgctgccggcgatggcg
aggcgcggccggggagccatcgtcaacgtcggctccggctccaccgtcgccgtcccgtct
tttcccttgtacactgtctacagctccaccaaacggtacgtggagcagctgtcgaagagc
ctgtacgtggagtacaaagggaaggggatcgacgtgcagctgcaggtgcccttctacgtc
cacacaaacatgctctccgccgccatcaaggacaggatgctgctgccggcgttcgtggcg
acggccgacgactacacgcgggcggcggcgcggtgggtggggcacggccacatcgccgtc
cccgacgccggccagcagctgcagtggttcctcgccgccttcgtgccggacttcgcccac
gactggtatcgcctccgcaagcacctgcagcaccgggccatcctctggaacctcatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336202
Entry
4336202           CDS       T01015                                 
Name
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4336202
   01040 Biosynthesis of unsaturated fatty acids
    4336202
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4336202
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     4336202
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     4336202
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4336202
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 4336202
NCBI-ProteinID: XP_015633654
UniProt: A3AUZ5 Q7XQF8
LinkDB
Position
4:complement(24175637..24178971)
AA seq 318 aa
MDALSAQPAWALALAGVGLMVAATASARLARWLYAAFLRPGKPLRRRYGEWAVVTGATDG
IGRALAFRFAGAGMSLVLVGRSPDKLAAVSGEIRGKHPRAEVRTFVLDFAAEGLAAKVAA
LGDSIRGLDVGVLVNSAGMSYPYARYFHEVDEELMRNLIRLNVEALTRVTHAVLPGMVER
KRGAIVNIGSGASSILPSYPLYSVYAATKAYVDQFSRCLYVEYKNKGIDVQCQVPLYAAT
KMASIKKASFFAPSPETYARAAVRYIGYEPRCTPYWPHAVLWFLISAFPEPIVDRLLLNM
SVGIRKRGMAKDARKKTQ
NT seq 957 nt   +upstreamnt  +downstreamnt
atggacgcgctgtccgcgcagccggcgtgggcgctggcgctggccggggtgggcctcatg
gtggccgcgaccgcctcggcgcgcctcgcgcggtggctctacgcggcgttcctccgcccg
gggaagcccctgcgccgccggtacggcgagtgggcggtcgtcacgggcgccacggacggc
atcggccgcgcgctcgcgttccgcttcgcgggcgccgggatgagcctcgtgctcgtgggc
cgcagccccgacaagctggccgcggtctccggggagatcagggggaagcaccccagggcc
gaggtccgcaccttcgtgctcgacttcgccgccgagggcctcgccgccaaggtggccgcg
ctcggggactccatccgcgggctcgacgtcggcgtgctcgtcaacagcgccggcatgtcg
tacccgtacgcgcgctacttccacgaggtggacgaggagctgatgcgcaacctcatccgc
ctcaacgtcgaggcgctcacccgggtcacccacgccgtgctcccaggcatggtggagcgc
aagcgcggcgccatcgtcaacatcggctccggcgcctcctccatcctgccgtcctacccg
ctctacagcgtctacgccgccaccaaggcgtatgttgatcaattctcgagatgcctctat
gttgagtacaagaacaaaggcatcgatgtgcaatgccaggtacccctgtacgcggcgacg
aagatggcgtccatcaagaaggcgtccttcttcgcgccgtcgccggagacgtacgcccgc
gccgccgtgcgctacatcgggtacgagccgaggtgcacgccctactggccgcacgcggtg
ctgtggttcctcatctccgcgttcccggagcccatcgtggacaggctcctcctcaacatg
tccgtcggcatccgcaagaggggcatggccaaggacgccaggaagaagacgcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340816
Entry
4340816           CDS       T01015                                 
Name
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4340816
   01040 Biosynthesis of unsaturated fatty acids
    4340816
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4340816
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     4340816
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     4340816
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4340816
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 4340816
NCBI-ProteinID: XP_015642538
UniProt: Q5ZA50 A0A0P0WVZ4
LinkDB
Position
6:complement(11116737..11118318)
AA seq 329 aa
MMASHFYGMFRQDDPAPAPAWWFQSLAFLGAAYVAGVTLRLLAYVAICLGGPKDLRRYGA
WAVITGPTSGIGCAMALELARRGLNLVLVGRDPARLREISGTIRSRHGRVQTKAVVFDLS
LASTPDGDQPLRRLREAVAGLDVGVVVNNASEGRPGAVYLHEADVEEWVRMARVNVSAVT
EVTAAVLPGMVERGRGGAVVNLGSAASEAIPSFPLYTMYASTKRYVAQFSRSLHVEYANK
GIHVQCQTPFFVETTMLAKLEEEVGLSVSPLKVSTDTYARAAVAWIGRGGPLCTPGGLLH
QLMWCITAAVPESVLDWIVLRFTTWNRGR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgatggctagccatttctacggcatgttccggcaagacgacccagcgccggcgccggcg
tggtggttccagtcgctggccttcctcggcgccgcctacgtcgccggcgtcacgctgcgc
ctcctcgcctacgtcgcgatctgcctcggcgggcccaaggacctccgccggtacggcgcg
tgggccgtcatcaccgggccgacgtccggcatcggctgcgccatggcgctggagctcgcg
cgccgcggcctcaacctcgtgctcgtcggccgtgaccccgccaggctccgggagatctcc
ggcacgatccgctcccgccacggccgggtgcagaccaaggccgtggtgttcgacctgtcc
ctcgcctcgaccccggacggcgaccagccgctgcggcggctgcgggaggccgtggcgggg
ctggacgtcggggtggtggtgaacaacgccagcgaggggaggcccggcgcggtgtacctc
cacgaggcggacgtggaggagtgggtgaggatggcgcgggtgaacgtgtcggcggtgaca
gaggtgacggcggcggtgctgcccgggatggtggagcggggcaggggcggcgccgtcgtc
aacctcggctcagcggcgtcggaggccatcccgtccttccccctctacaccatgtacgcc
tccaccaaacggtacgtggctcagttctcccggagccttcacgtcgagtatgcgaacaaa
gggatccatgtgcaatgccagacgccgttcttcgtggagacgacgatgttggcgaagttg
gaggaggaggtggggcttagcgtgtcgccgttgaaggtgagcacggacacctacgcgcgc
gcggcggtggcgtggatcggacgcggcgggccgctctgcacgccgggtggactgctgcac
cagctgatgtggtgcatcaccgccgccgtgccggagtccgtcctcgactggatcgtcctg
cgcttcaccacctggaacagaggacggtag

DBGET integrated database retrieval system