KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276303
Entry
107276303         CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L13-like
  KO
K02871  large subunit ribosomal protein L13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107276303
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107276303
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107276303
  Bacteria
    107276303
  Archaea
    107276303
SSDB
Motif
Pfam: Ribosomal_L13
Other DBs
NCBI-GeneID: 107276303
NCBI-ProteinID: XP_015649023
UniProt: A0A0P0XC97
LinkDB
Position
8:3636001..3638219
AA seq 202 aa
MAAAPPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVLGRLASQIAVVLQGKDKPTYAP
HVENGDMCVVLNAKDISVTGRKMTDKIYYWHTGYIGHLKERRLKDQMEKDPTEVIRKAVM
RMLPRNRLRDDRDRKLRIFSGSEHPFHDRPLEPFAMPPRQVREMRPQARRALIRAQKKEQ
DRAAASTKDDKDGKSANTDVTS
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctgccgcgccgccggcgttcaccgggaacctcaagaaagcacttgcaggattgaga
aggatcaatttagatgggttgagatggcgtgtatttgatgcaaagggtcaggtgcttgga
cggttggcatcccaaattgctgttgtgcttcaagggaaggacaagccaacttatgcacca
catgtggaaaacggggacatgtgtgtcgtacttaacgcgaaagatatcagtgtcacggga
aggaaaatgactgataagatttactactggcacacagggtatattggccatttgaaggaa
agaagactcaaggaccagatggaaaaggacccaaccgaggtgattcgcaaagctgtgatg
cgcatgcttccccgcaatagattgcgtgatgatagggatcgcaaactgaggatattttct
ggaagtgagcatcccttccatgatcgccctcttgaaccttttgcgatgccaccgcgtcag
gtgcgcgagatgcgcccccaggcaagacgggcacttattagggcgcagaagaaagagcag
gacagagcagcagcatcaaccaaagatgacaaagatggtaagagtgccaatactgatgtc
acttcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325555
Entry
4325555           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L13, chloroplastic
  KO
K02871  large subunit ribosomal protein L13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4325555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4325555
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4325555
  Bacteria
    4325555
  Archaea
    4325555
SSDB
Motif
Pfam: Ribosomal_L13
Other DBs
NCBI-GeneID: 4325555
NCBI-ProteinID: XP_015623039
UniProt: Q94J17 A0A0N7KDR4
LinkDB
Position
1:31367020..31369411
AA seq 233 aa
MATAIAASAFLSSAFARDRPLPRQRRAARPATRRAAAGGLSVRCEQSEKQKRQPLSALVP
REQRFMFEGDELCGPDIWNTTWYPKAADHVTTEKTWYVVDATDKILGRLASTIAVHIRGK
NEATYTPSVDMGAFVVVVNAEKVAVSGKKRSQKLYRRHSGRPGGMKEETFDQLQKRIPER
IIEHAVRGMLPKGRLGRRLFTHLKVYKGAEHPHEAQKPVPLPIKDKRIQKSEK
NT seq 702 nt   +upstreamnt  +downstreamnt
atggctacggccatcgcagcctccgcgttcctctcctccgccttcgccagggacaggccg
ctcccccgccagcggcgcgcggcgaggcccgcgacccgccgcgccgccgcggggggcctg
tcggtgcggtgcgagcagagcgagaagcagaagaggcagccgctctccgcgctcgtcccc
cgcgagcagcgattcatgttcgaaggcgacgagctctgcggccccgacatatggaacaca
acatggtaccctaaggctgcagatcatgtaactactgagaagacatggtatgttgttgat
gcaacagacaagattctaggtaggcttgcatccaccattgcagtacacatcagaggaaag
aatgaggccacatacactccaagtgtggacatgggggcttttgttgttgtggttaatgca
gagaaggttgctgtttctggcaaaaagcggtcacagaagctctacaggaggcactctgga
cggcctggtggaatgaaagaagaaacttttgatcagcttcagaaaaggattccggagaga
attattgaacatgcagtgcgtggcatgcttcctaagggcagactgggaagaagactgttt
acccacctcaaggtgtacaagggagcagaacatccccatgaggctcaaaaacctgttcca
ctgcctatcaaggataaaagaatacagaagtctgagaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338198
Entry
4338198           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4338198
  KO
K02871  large subunit ribosomal protein L13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338198
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338198
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4338198
  Bacteria
    4338198
  Archaea
    4338198
SSDB
Motif
Pfam: Ribosomal_L13
Other DBs
NCBI-GeneID: 4338198
NCBI-ProteinID: XP_015640201
UniProt: Q0DJQ1 Q60E13
LinkDB
Position
5:complement(8689406..8696486)
AA seq 160 aa
MLPAALLPHLLIPPMMGRIASPLIPPKPGRITWPRSGRTPGTPMTSSPPMLWSTRCWSNA
SALLWSPPPRIRSPSPSLSRSWTYNEPLLAAILVSTAKSCSALADLRRINLDGLRWCVFD
AKGQVLGRLASQIAVVLQGKDKPTYAPHVENRDMCVVLNG
NT seq 483 nt   +upstreamnt  +downstreamnt
atgctgccggcggcgctgcttccacatcttctgatcccaccgatgatggggaggatagcc
tcgcctctgatcccaccgaagccggggaggataacctggcctcgctctgggaggacgccg
gggacgccgatgacatcttcgccgccgatgctatggtcgacgaggtgctggtcgaacgcg
tctgcgctgttgtggagtccacccccgaggatcagatccccttcgccctcgctttcaagg
tcgtggacttacaacgagccactcctcgccgccattctcgtgtccaccgccaagagctgc
tccgcacttgcagacttgagaagaatcaatttagatggtttgagatggtgtgtatttgac
gcaaagggccaggtccttggacggttggcgtcccaaatagctgttgtgcttcagggcaag
gacaagccaacttatgcaccacatgtggaaaacagagacatgtgcgttgtgcttaatgga
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338199
Entry
4338199           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338199
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338199
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4338199
  Bacteria
    4338199
  Archaea
    4338199
SSDB
Motif
Pfam: Ribosomal_L13 DUF4874
Other DBs
NCBI-GeneID: 4338199
NCBI-ProteinID: XP_015637315
UniProt: Q60E11 A0A0P0WJP3
LinkDB
Position
5:complement(8697522..8704088)
AA seq 191 aa
MKALAGLRRINLDGLRWRVFDAKGQVLGRLASQIAVVLQGKDKPTYAPHVENGDMCVVLN
AKDISVTGRKMTDKIYYWHTGYIGHLKERRLKDQMEKDPTEAIRKAVMRMLPRNRLRDDR
DRKLRIFSGNEHPFHDRPLEPFMMPRRQVREMRPRARRALLRAQKKEQDRAAAASTKDEE
NAKNAKSEITA
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaaagcacttgcaggtttgagaagaatcaatttagatggattgagatggcgtgtattt
gacgcaaagggccaggtccttggacggttggcatcccaaatagctgttgtgcttcaggga
aaggataagccaacttatgcaccacatgtggaaaatggagacatgtgcgttgtgcttaat
gcaaaagatatcagtgttacaggaagaaaaatgaccgataaaatctactactggcacaca
gggtatattggccatttgaaggaaagaagactcaaggaccagatggaaaaagacccaact
gaagcaattcgcaaagctgtcatgcgcatgcttcctcgcaatagattgcgtgatgacagg
gatcgtaaactgaggatattttctggaaatgagcacccattccatgatcgccctcttgaa
ccttttatgatgccacgacgccaagtgcgcgagatgcgtccccgggcaagacgcgcactg
ttaagggcgcagaagaaagagcaggacagagcagcagcggcatcaaccaaagatgaagaa
aatgctaagaatgccaaatccgagatcactgcatag

DBGET integrated database retrieval system