KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276319
Entry
107276319         CDS       T01015                                 
Name
(RefSeq) alcohol-forming fatty acyl-CoA reductase-like isoform X1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    107276319
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107276319
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     107276319
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD GDP_Man_Dehyd SpoOE-like
Other DBs
NCBI-GeneID: 107276319
NCBI-ProteinID: XP_015645722
LinkDB
Position
7:18106122..18111590
AA seq 493 aa
MDAATVAGYFKDKSILITGSTGFLGKIFVEKILRIQPDVKKIFLLVRAADTSSAEQRVLN
EVIGNELFGPLRENYGSNFYSFMKEKISPLAGDIINENLGLESLEILKLSKEIDIIVNGA
ATTNFYERYDVSLASNVLGAKYVCKFAKKCANLKMFLHISTAFVSGEQEGLLLEKVFQIG
ETLKEGCHLDIAAELQLVESVKAELTHSTNGKSEQTEKITMKKLGLKRARQFGWPNTYVF
TKAMGEMLVGHFGRELPVVIIRPSIVSSIYHDPLPGWIEGTRTIDSIISAYAKQTIPHFI
GAGHVILDVIPGDMVVNAMLVAMAVHWSERGQVIIHVTSSQQNPLSTSTMLDLMYRYFTA
NPQTMGKNGKVVKTKRLNITNKTGFRAYMFLKYKLPLEVLHLVNPLLGGYFSQYYNKSIR
SYRYFVLLAKLYMPYAFFNACFNGTNLARLQTATTQDQSKEACVLNFDPKSIDWEYYLYN
SHIPGVMKYAHKK
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggacgcggctacagttgcaggatatttcaaggacaagagcattttgatcactggctca
actggatttcttggaaaaatattcgtggagaagatactgagaattcagcctgatgtgaag
aagatttttctcctggtgagggccgccgatacatcatccgcggagcagcgtgtgctgaat
gaggttatagggaacgaactctttgggcccttgcgagaaaactatggatctaatttctat
agcttcatgaaggaaaagatatcacctttagccggagatatcattaatgagaatttaggc
cttgagagcttggaaatattaaaattgtcaaaggagattgatatcattgttaatggagct
gcaacaacaaatttttatgaaagatatgatgtttccttggcatccaatgtcttaggagca
aaatatgtttgcaaatttgcaaagaagtgtgcaaatctgaaaatgttcctccatatttcc
actgcatttgtatctggagagcaagaaggacttttattggagaaggtatttcagattggg
gaaacactgaaggaaggatgccatttagacattgcagctgaattacaattggttgagtct
gtcaaggcagaacttacgcactccaccaatggtaaatcggagcaaacagaaaagataacc
atgaagaaacttggattgaagagagctagacaatttgggtggcccaacacgtatgtgttc
acaaaggcaatgggtgagatgctagttggacactttgggcgtgaacttccggttgtgatt
attcgcccaagtattgtatccagcatttaccatgatccgctccctgggtggatagaagga
actaggacaattgacagtataatttctgcttacgccaagcaaactattccacatttcatc
ggtgctggtcatgtcatccttgatgtgattcccggtgatatggtggtgaatgcgatgttg
gtagccatggccgttcactggagtgagagaggccaagttatcatccatgtgacatcatcc
cagcagaacccgttgtcaacctctaccatgctggacttgatgtatcgctattttactgct
aatccacagacaatgggaaagaacggaaaagtcgtcaaaaccaaaaggctcaacattacc
aataaaacaggtttccgagcatacatgtttcttaaatacaagctacctttagaggttctg
catttggtgaatccactattgggtggatatttttctcagtattacaataaatccataaga
agctacagatatttcgttcttctggccaagttatacatgccatatgctttcttcaacgcc
tgcttcaatggcacaaacttggcaagactgcagacggcgacaactcaagaccagagcaaa
gaagcctgtgtgcttaattttgatcccaagtccattgactgggagtactatctgtacaac
agccacatacctggcgttatgaagtatgcccacaaaaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278422
Entry
107278422         CDS       T01015                                 
Name
(RefSeq) fatty acyl-CoA reductase 1-like isoform X1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    107278422
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107278422
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     107278422
SSDB
Motif
Pfam: NAD_binding_4 Sterile
Other DBs
NCBI-GeneID: 107278422
NCBI-ProteinID: XP_015647953
LinkDB
Position
7:complement(13149715..13178596)
AA seq 566 aa
MSPKKNPFPISFKLSTLIIVKVHLAELLLRLLYCQAHPHRSCSRNHHPSRLLDQSGHGAR
RCCRALPQPDRTHHGRHRFHSETTCGEDPAAAAGCEEALPSRARCGSGFREQESRIRVLF
YMSYQIMQLPIFQPLREKYQTHFSSWFWDKVFPLAGDVSLKNFGIGDARLAEDIRKETNI
IVHMAATVNFAERYDTALAINTMGVKHMIDFASKCTNLELVLLVSTAYVNLMKQAYVNLM
KQGIMMEKPLQQWRSYDGRSDLDISEEMAFKDEKLKELVYNNASERTIRHTMKKIGAQRA
KKFGWANAYVFTKAMGEMLAYEQNSRLPIVIIRPSATTSTWKEPFPGWIEGAKAIDTWIT
NYGKGTLKFFPTDVATVIDIVPADIVVNAMLCIISYHPQGTADFIYQIGSSMSNPIKLGQ
MSQTTYKYFSQIPFVGAKGDVVKVKQPNFLATMASFYETMDKHYKMPLQDMLRRGLSTTE
DRHIYNHLKREYDFTVAVAEVYWPFTISKTRFDDSKMQNLMGMVTERDRELIPCNIKFIN
WDKYFMETHIPGVMDYESRELTRARL
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgtcaccaaaaaaaaatccatttcccatttctttcaagttgtcgactctaataattgtt
aaggtccatctagcagagctcctactccggcttctatattgtcaagcacaccctcatcgt
tcctgctcgcgcaaccatcacccgagtcggttgctcgatcagtctgggcatggagctcgc
cggtgttgcagagcgcttccacagccggaccgtactcatcacgggcgccaccggtttcat
agcgaaactacttgtggagaagatcctgcggctgcagccgggtgtgaagaggctctacct
tctcgtgcgcgctgcggatcaggtttccgcgaacaggagagtcgaatccgagttctcttc
tacatgtcatatcagatcatgcaacttccgatatttcaacccttgcgggagaagtatcaa
acgcacttcagttcatggttctgggacaaggtttttcctctagcaggagatgtgtccttg
aagaatttcggtataggagacgctagactggctgaagatataaggaaagaaacaaatatt
attgttcacatggctgcgacagtaaacttcgcagaaagatatgatacagcgttggcaata
aacactatgggtgtgaagcatatgatagattttgcatcaaaatgcacaaacctagagctc
gttcttcttgtgtcaacagcttatgtcaatctaatgaaacaagcttatgtcaatctaatg
aaacaagggatcatgatggagaagccgcttcaacaatggaggagttatgatggtcgatca
gatctagatatttcagaagagatggcatttaaggatgaaaagttgaaggagctagtttac
aacaatgcttcagaacgtaccataagacacaccatgaaaaagataggcgcacaaagagct
aagaagtttggatgggcgaatgcctatgtgttcacaaaagcaatgggtgagatgctggca
tatgaacaaaactcacggctcccaattgttatcatccgtccatcagccacaacaagcaca
tggaaggagccttttcctggatggatagaaggagccaaagcaattgacacatggatcact
aactatggtaaggggacactgaagttttttcctacagatgtggcaacagtcatagacatt
gtacctgcagacattgtggtcaatgcgatgctttgtattatcagctaccatcctcaagga
acagcagacttcatctatcagattggttcttccatgagcaacccgatcaagcttggccag
atgtctcaaacaacgtacaaatacttctcgcagataccattcgtcggtgcaaaaggagat
gtagtcaaggtgaaacaaccgaattttctagcaacaatggccagcttctacgagaccatg
gataaacactacaaaatgcctttgcaggatatgttgcgccgtgggttatctaccactgaa
gaccgtcatatttacaaccatctcaagagagagtatgattttactgttgccgtggcagag
gtatactggccattcacaatatccaaaacgaggttcgatgactcgaaaatgcagaatctt
atgggaatggttactgaaagagaccgagaattgataccctgtaatataaagttcatcaat
tgggacaagtactttatggaaactcacatccccggtgtcatggattatgagtcaagggaa
ttgacaagagctaggctatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331746
Entry
4331746           CDS       T01015                                 
Name
(RefSeq) fatty acyl-CoA reductase 2
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    4331746
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4331746
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     4331746
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 4331746
NCBI-ProteinID: XP_015632305
UniProt: Q0DUU1 Q8S7T9
LinkDB
Position
3:3653232..3657038
AA seq 608 aa
MGMSSCVNLSRVAAAAAGRRPGFAGELGGRRGHGRSVLPVVAALPVRRKGSGCGVACCVS
SSSSSSVHGKNSAAAAEGHAGGIGIAEFLGGKNFLITGGTGFLAKVLIEKILRTNPDVGK
IYVLIKAKDGDAALKRLHNEVVDTELFSRLQEIHGKDYHSFAARKLVPVVGDVREANVGI
APELAGVIADEVDIIVNSAANTTFDERYDVAMDINTVGPFRIMSFAQRFRRLKLFLQVST
AYVNGQRQGVVLEKPFRLGDTIAKELGSPDSSQHKNTMLDIEAEIKLAFDHRRHGDDSAS
FSEEMKELGLERAKLHGWQDTYVFTKAMGEMVINSMRGDIPVVTIRPSVIESTWRDPFPG
WMEGNRMMDPVVLYYGKGQLSGFLADPEGVLDVVPADMVVNATLASMAKHGRGGAAAAAA
AAEGMHVYHVASSTVNPLAFGDLSRFLFQHFTGSPYSDAAGRPIHVPPMRLFDTMEQFAS
YVETDALLRAGRLAGAGAGAGDERVSQRLRELCAKSVEQTIYLGSIYQPYTFYGGRFDNG
NTEALIGEMSEEEKARFHFDVRSIEWTDYITNVHIPGLRKHVMKGRGVGGGSGASSSSNA
SLLAGASV
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggggatgagttcatgcgtgaacctatcccgtgtcgccgccgccgccgcagggagacgg
ccgggatttgccggtgagctgggaggtcgccgtggtcatggcagaagcgtgcttccggtt
gttgctgcactgccggtgaggaggaagggaagcggttgtggcgtggcgtgctgcgtctcc
tcctcgtcttcctcctccgtgcacggcaagaactcggcggcggcggcggagggtcacgcc
ggcggcattgggatcgcggagttcctcggcggcaagaacttcctcatcaccggcggaacc
gggttcctggcaaaagttctcatcgagaagatattgcggacgaatcccgacgttggcaag
atctacgtgctgatcaaggcgaaggacggtgacgcagcactgaaaagattgcacaacgag
gttgtggacacagaattgttcagtcgtttgcaggaaatccatggcaaggattaccacagc
ttcgcggcaagaaagctggtgcctgtagtcggagatgtcagagaagccaacgttggcatc
gcccctgagcttgccggcgtgatcgccgacgaggtcgacatcatcgtcaactcagcagca
aacaccactttcgacgagaggtacgatgttgcaatggacatcaacaccgtagggccattc
aggataatgagcttcgcgcagcggtttcggaggctgaagctgttcttgcaagtgtcaaca
gcatatgtgaacggacagaggcaaggtgtggtgctagagaagccatttcgcttgggggac
accatagccaaggagttaggatctccagattcttcacaacacaagaacaccatgcttgac
atcgaggcagagatcaagctggcttttgaccacaggagacacggtgatgattcagcctct
ttctctgaagaaatgaaagagttaggattagagagggcaaaactccatgggtggcaagat
acatatgtgttcaccaaggccatgggagagatggtgatcaactccatgcgaggagatata
ccggttgtcaccatcaggccaagcgtcatcgagagcacctggagggatcccttccccggt
tggatggaagggaacaggatgatggatcctgttgtgctgtactacggcaaaggccagctg
agcgggttcctcgctgacccggagggtgttcttgacgtggttccggcggacatggtggtg
aacgcaacgctggcgtccatggcgaagcacgggcgcggcggcgcggcggcggcggcggcg
gcggcggaggggatgcacgtgtaccacgtggcgtcgtcgacggtgaacccgctggcgttc
ggcgacctgagccggttcctcttccagcacttcacggggtcgccgtacagcgacgcggcg
gggcggcccatccacgtgccgccgatgcggctgttcgacaccatggagcagttcgccagc
tacgtcgagaccgacgcgctgctgcgcgccggccgcctcgccggcgccggcgccggcgcc
ggagacgagagggtgtcgcagcggctgcgcgagctctgcgccaagtccgtcgagcagacc
atctacctcggcagcatctaccagccctacaccttctacggcggcaggttcgacaatggg
aacacggaggcgctgatcggggagatgtcggaggaggagaaggcgcggttccacttcgac
gtgaggagcatcgagtggacggactacatcaccaacgtgcacatcccggggctcaggaag
cacgtcatgaaggggaggggcgtcggcggcggcagcggcgcgtcgtcgtcatcgaacgcc
tcgctgctcgccggcgcctccgtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335559
Entry
4335559           CDS       T01015                                 
Name
(RefSeq) fatty acyl-CoA reductase 1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    4335559
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4335559
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     4335559
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase RmlD_sub_bind Polysacc_synt_2 adh_short GDP_Man_Dehyd 3Beta_HSD KR
Other DBs
NCBI-GeneID: 4335559
NCBI-ProteinID: XP_015635269
UniProt: A0A0N7KIW3 Q7XS02
LinkDB
Position
4:16882609..16890103
AA seq 497 aa
METGGIAERFRDKTILITGATGFLGKLLVEKILRVQPEVRKLYLLVRAPDAIAAEERVLT
EVVGNGLFDVLREQYGAGFHSFIKEKIYALPGDVTHENFGLESYDILQLSQKVDIIVNGA
ATTNFMERYDVALATNTTGVVHLCQFAKQCDNLKMVLHVSTAYVAGEQAGQIFEKPFQIG
TALRLDYQLDIEAELQLVDKIKSELGINSDSKLEKITMRKLGLERAVHFGWPNTYTLTKA
MGEMLLQQLGQDLPVVIVRPSMITSTFQEPMPGWIEQTRTIDVIFVAYNDQTLPCFIFDG
SVIFDLIPGDMVINAMMAAINSQWNKQAQVIYHVTSSHQNPVPLSLIEESLYKYFHKNPR
TSKDGKAIQNEKILTFNRLVYFQAYMILRYKVPLEMMRAANVLLGGIYTKNYYELNRGYN
ILMTVAKLYAPYVFFKGWFDDTNLRKLWKATAMDQNDDASIFNFDPKCINWSSYLVNTHI
PAAIKYANNQKTKARSA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagacaggaggcatagcggagcgtttcagagacaagactatactcatcaccggcgct
actggcttcctgggaaaattgctggtggagaagatactacgagttcagccggaggtgagg
aagctatacctgctagttcgtgctccggacgccatagctgccgaggaacgtgttctcact
gaggttgtaggaaatggtctatttgatgttctgcgagaacaatacggtgctgggttccac
tccttcatcaaggaaaaaatatacgctctacctggagatgtgacgcatgaaaactttggg
cttgagagttatgacatcctgcagttatcccagaaggtagatatcatcgtcaatggagct
gcaacgacaaactttatggagaggtatgatgtcgctttagcaacaaatacaacaggagtc
gtgcatttatgtcagtttgcaaagcagtgtgataacctcaagatggtgcttcatgtttcc
accgcttatgtagccggtgagcaagcaggccagatattcgagaaaccattccagatcggt
acagcattacgactggattaccagttggacattgaagctgagctgcaactagtggacaag
atcaagtcagaactcggaataaacagtgacagcaagttagaaaaaataaccatgaggaaa
cttgggcttgaaagggccgtgcactttggttggccaaatacatacacactgacgaaagct
atgggggagatgttacttcaacaattgggacaagaccttcccgttgtcatcgtccggcca
agcatgataacaagcacttttcaggaaccaatgcctgggtggatagaacaaactaggaca
attgatgtcatatttgttgcatacaatgaccaaacccttccatgttttatatttgatggt
agtgttatatttgacctgatacctggggatatggtgatcaacgcaatgatggcagccata
aacagtcagtggaataaacaagctcaagtgatataccatgtgacttcctctcaccaaaat
cccgtaccgttatctcttattgaagaatcattgtacaaatactttcacaaaaatccacgt
acaagtaaagatgggaaggcaatacaaaatgaaaaaattttaacgttcaataggttagta
tacttccaggcatacatgattctacggtacaaggtaccattggagatgatgcgtgcagca
aatgtactgttgggagggatatacaccaagaactactatgagcttaaccgaggctacaac
attttaatgactgtggcaaagctgtatgccccatatgtattcttcaaaggatggtttgat
gacaccaacctgaggaaactgtggaaggcgacggctatggaccaaaatgatgatgcatcc
atatttaattttgatcctaagtgcattaactggagctcatacctcgtgaacacccacatt
ccagctgctataaagtatgccaataaccagaagacgaaagcacgcagtgcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335561
Entry
4335561           CDS       T01015                                 
Name
(RefSeq) alcohol-forming fatty acyl-CoA reductase
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    4335561
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4335561
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     4335561
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase RmlD_sub_bind 3Beta_HSD
Other DBs
NCBI-GeneID: 4335561
NCBI-ProteinID: XP_015635295
LinkDB
Position
4:16915564..16924139
AA seq 476 aa
MEPGSIAERFRDRSILITGSTGFLAKMLVEKILRVQPEVRKLYQLVRAPDAAAAEERVLT
EVVGKGLFDVLRKQHGAAFYSFIKKKICPLAGDVMHENFGLGSSEILRLSHEVDIIVNGA
ATTNFMDRYDVALATNTEGVMHLCHSAKQCDNLKMLLHVSTAYVAGEQAGLLLEKPFQIG
EALRQGYTLDVEAEVQLVDRIKSKLRIKSSIHNKLEKTTMKKLGLKRAMHFGWPNTYVLT
KAMGEMLLRQLGGDLPVVIVRPSIITSTFQDPMPGWIEETRTIDAIFVAYNDQTLPCFIF
DGSVIFDLIPGDMVISAMMAAINSHWNKQAQVIYHVTSAHQNPIQLSLIEESMYKYFHTN
PRTNKDGESIKNKRVLMFKRFAYFQAYMALRYKLPLEIMRAANALFGGIYTKNYNKLNRG
YNILMTVAKLYAPYDFFKGCFDDTNLRKLWKATAMDQNDASKLILILTASTGAHTW
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggagccgggaagcatagccgagcgtttcagagataggagcatactcatcaccggctct
actggctttctggcaaaaatgttggtggagaagatactgcgagttcagccggaggtgagg
aagctctaccagctggtgcgtgctccagacgccgcagctgccgaggagcgtgttctcaca
gaggttgttggaaaaggtctatttgatgttctgcgaaaacaacacggtgctgctttctac
tccttcatcaagaaaaaaatatgccctctagctggagatgtcatgcatgaaaactttgga
cttgggagctctgagatcctgcggttatcacacgaggtcgacatcatcgtcaatggagct
gcaacgaccaactttatggacaggtatgatgttgctttggcaaccaacactgaaggagtc
atgcatttgtgtcactctgccaagcagtgcgataacctcaagatgctccttcatgtttcc
accgcttatgttgctggtgagcaagcaggcttgttacttgagaaaccattccaaattggt
gaagcactacgacaaggttacaccctagatgttgaagctgaggtgcaattagtagacagg
atcaagtcaaaactcagaataaaatcttccattcacaacaagttagaaaaaacaaccatg
aagaaacttgggcttaaaagggctatgcactttggttggccaaatacatatgtgctgaca
aaagctatgggggagatgttacttcgacaattgggaggagaccttccagttgtcatcgtc
cggccaagcataataacaagcacttttcaggatccaatgcctggatggatagaagaaact
aggacaattgatgccatatttgttgcctacaatgaccaaacccttccttgttttatattt
gatggtagtgttatatttgacctgataccaggagatatggtgattagtgcaatgatggca
gccataaatagtcactggaataaacaagctcaagtgatataccatgtgacttcggctcac
caaaatcccatacaattatctcttattgaagaatcgatgtacaaatacttccacacaaat
ccacgtacaaataaagatggggagagcataaaaaacaaaagagttttaatgttcaagaga
ttcgcatacttccaggcatacatggctctacggtataagttgccattagagataatgcgt
gcagcaaatgcactgttcggagggatatacaccaagaactacaataagcttaaccgaggc
tataacattttaatgactgttgcaaagctgtatgctccatatgactttttcaaaggatgc
tttgatgacaccaacttgaggaagctgtggaaggcaacggctatggaccaaaatgatgca
tccaaattaattttgatcctaactgcatcaactggagctcatacctggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335562
Entry
4335562           CDS       T01015                                 
Name
(RefSeq) fatty acyl-CoA reductase 1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    4335562
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4335562
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     4335562
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase RmlD_sub_bind Polysacc_synt_2 GDP_Man_Dehyd 3Beta_HSD KR
Other DBs
NCBI-GeneID: 4335562
NCBI-ProteinID: XP_015635132
UniProt: B9FEM1 Q7XRZ6
LinkDB
Position
4:16945194..16951557
AA seq 499 aa
METGGIAERFRDKTILITGATGFLGKLLVEKILRVQPEVRKLYLLVRAPDAIAAEERVLT
EVVGKGLFDVLREQYGAGFNSFIKEKIYALPGDVMHENFGLESYEVLQLSQKVDIIVNGA
ATTNFMERYDVALATNAAGVMHLCQFAKQCDNLKMVLHVSTAYVAGEQAGQLLEKPFQIG
RALRLDYQLDIEAELQLVDSIKSELRIKCSSDDKLEKTTMRKLGLKRATHFGWPNTYVLT
KAMGEMLLQQLGQDLPVVIVRPSMITSTFQEPMPGWIEETRTIDVIFVAYNDQTLPCFIF
DGSVIFDLIPGDMVINAMMAAINSQWNKRAQVIYHVTSAHQNPLPVSLIEESMFRYFDIN
PRTSKDGKAIKNKRPLAFKRLAYFQAYMILRYKLPLEMMRAANVLLGGIYTKNYYEFNRD
YNILMTVAKLFAPYVFFKGWFDDTNLRKLWKATAMDQNDDASIFNFDPKCINWSSYLVNT
HIPAAIKYANDQKAKARSA
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggagacaggaggcatagcggagcgtttcagagacaagactatactcatcaccggcgct
actggcttcctgggaaaattgctggtggagaagatactgcgagttcagccggaggtgagg
aagctatacctgctagttcgtgctccggacgccatagccgccgaggagcgtgttctcact
gaggttgtaggaaaaggtctatttgatgttctacgagaacaatacggtgctggattcaac
tccttcatcaaggaaaagatatatgctctacctggagatgtgatgcatgaaaactttggg
cttgagagttatgaggtcctgcagttatcccagaaggtagatatcatcgtcaatggagct
gcaacgacaaactttatggagaggtatgacgtagctttggcaacaaacgctgcaggagtc
atgcatttatgtcagtttgcaaagcagtgtgataatctcaagatggtgcttcatgtttcc
actgcttatgtagctggtgagcaagcaggccagttactcgagaaaccattccagatcggt
agagcactacgactggattaccaattggacattgaagctgagctgcaattagtggacagt
atcaagtcagaactcagaataaaatgttccagtgatgacaagttagagaaaacaaccatg
aggaaacttgggcttaaaagggccacgcactttggttggccaaatacatatgtgctgacg
aaagctatgggggagatgttacttcaacaattgggacaagaccttccggttgtcatcgtc
cggccaagcatgataacaagcacttttcaagaaccaatgcctggatggatagaagaaact
aggacaattgatgtcatatttgttgcctacaatgaccaaacccttccatgttttatattt
gatggtagcgttatatttgacttgatacctggggatatggtgatcaacgcaatgatggct
gccataaatagtcaatggaataaacgagctcaagtgatataccatgtgacttcggctcac
caaaatcccctaccagtatctcttattgaagaatcaatgttcagatactttgacataaat
ccacgtacaagtaaagatgggaaggcaataaaaaataaaagaccactagcattcaagaga
ttagcatacttccaggcatacatgattctacggtacaagctgccattggagatgatgcgt
gcagcaaatgtactgttgggagggatatacaccaagaactactatgagtttaaccgagac
tacaacattttaatgactgtggcaaagctgtttgccccgtatgtcttcttcaaaggatgg
tttgatgacaccaacctgaggaaactgtggaaggcgacggctatggaccaaaatgatgat
gcatccatatttaattttgatcctaagtgcattaactggagctcatacctcgtgaacacc
cacattccagctgctataaagtatgccaatgaccagaaggcgaaagcacgtagtgcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346301
Entry
4346301           CDS       T01015                                 
Name
(RefSeq) fatty acyl-CoA reductase 1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    4346301
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4346301
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     4346301
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase 3Beta_HSD Polysacc_synt_2 GDP_Man_Dehyd RmlD_sub_bind
Other DBs
NCBI-GeneID: 4346301
NCBI-ProteinID: XP_015650263
UniProt: A0A0P0XI81 Q6ZJ06
LinkDB
Position
8:27916290..27922616
AA seq 509 aa
MMASDRLDAERIIEYFKGKSILITGATGFLGKILVEKILRVQPDVKKIYLLVRAIDQASA
NQRVQSEVTETELFSVVKEKHGKGFSRFIEEKVVALAGDIIYDDLGLDPPLLQHLADNLD
VIVNGAATTNFYGRYDVSLDVNVLGVKHLCQLAKKCRGLKVFLHVSTAYAGGEQEGLIQE
RAFEEGWALREGMHLDVDAELRLVADVRREVEDDDDKARRKAMKELGLARARHFGWSNTY
VFTKAMGEMVLSRMLLQSSSPAPAITGAGGVVVVRPSIITSIQRDPVPGWMQGTRTIDTL
IIGYAKQNLSCFLGDLDLVMDVIPGDMVVNAMMAAAVAHSGEAGQERPAVYHVSSSLRNP
AAYSVLYEAGRRHFTEKPRVGKRGEVIPTKEMHFFKTIASFQVYMLVKYRLPLEILHLVN
LLLCGLFSRLYSNLARQYRYVMHLVDVYGPFAFFKGCFDDINLERLRQRMGKSRNPQDDE
MFNFDPKTIDWEDYFYRIHIPGVLKYILK
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgatggcttctgataggttggatgcagaaaggatcatagagtacttcaagggcaagagc
atcctcatcactggagcaactggctttcttggcaagattcttgtggagaagatactgagg
gtgcagcctgatgtcaagaagatctacctgctcgttcgcgccatcgaccaagcatctgca
aaccaacgcgtccaatctgaggtgacggagacggagctgttcagcgtggtgaaggagaag
cacggcaagggattctcgcgattcatcgaggagaaggtggtcgccctcgccggcgacatc
atctacgacgacctgggcctcgatcccccgttgcttcaacacctcgccgacaacctcgac
gtcatcgtcaatggcgctgccaccaccaacttctacggcaggtatgatgtgtcgctggat
gtgaatgtgctgggagtgaagcatctgtgccaattggccaagaaatgcaggggcctcaag
gtcttcctccatgtctccactgcttacgcgggcggcgagcaggaggggctaatccaggag
agggcgttcgaggaggggtgggcgctgcgagaggggatgcacctggacgtggacgcggag
cttcggctggtggccgacgtgcgtcgggaggttgaagacgacgacgacaaggcgcggagg
aaggcgatgaaggagctggggctcgccagggcgcgccacttcgggtggtccaacacctac
gtcttcaccaaggccatgggcgagatggtgctgtccaggatgctgctgcaaagctcgtcg
ccggcgccggcgatcaccggcgccggcggcgtggtggtggtgcggccgagcatcatcacg
agcatccagcgggacccggtgccggggtggatgcaggggacgcggacgatcgacacgctc
atcatcgggtacgcgaagcagaacctgtcgtgcttcctgggcgacctggacctggtgatg
gacgtcatcccgggggacatggtggtgaacgcgatgatggcggcggcggtggcgcactcc
ggcgaggccgggcaggagcggccggcggtgtaccacgtgagctcgtcgctgcggaacccg
gcggcgtactcggtgctgtacgaggccgggcggcggcacttcacggagaagccgagggtt
gggaagcgcggcgaggtcatccccaccaaggagatgcacttcttcaagaccatcgccagc
ttccaggtgtacatgctggtgaagtacaggctgccattggagatcctccacctggtgaac
ctcctcctttgtggcctcttctcccgcctctactctaacctcgcccgccagtaccgctac
gtcatgcacctcgtcgacgtctacggccccttcgccttcttcaaaggatgcttcgacgac
ataaacttggagaggctgaggcagaggatggggaagagcaggaaccctcaagacgatgaa
atgttcaacttcgacccaaagaccatcgattgggaggactacttctacaggatccatata
cccggtgtgctcaagtacatcctcaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347887
Entry
4347887           CDS       T01015                                 
Name
(RefSeq) putative fatty acyl-CoA reductase 7
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    4347887
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4347887
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     4347887
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2
Other DBs
NCBI-GeneID: 4347887
NCBI-ProteinID: XP_015610853
UniProt: Q0IZI9 A0A0P0XQF8
LinkDB
Position
9:22660707..22665359
AA seq 505 aa
MVGTMDEARIIEYFKNKSILITGSTGFLGKILVEKILRVQPDVRKIYLPVRAVDAATAKQ
RMQTEVIGKELFGLLKEQHGKGFQSFIDEKVVPLAADMMHQNLGLEESTLQELAKDLNII
VNGAATTNFYERYDVALDVNVMGVKYLCQLAKKCANLEVFLHVSTAYVCGERSGVVQERA
LREGETLREGTYLDIETELRLVGEQRQQLEDAGDAKAERKAMKDLGLARARHFGWPNTYV
FTKAMGEMMLQEQLVAGAGRRHGIPVVIARPSIITSVHRDPLPGWIEGTRTIDAIIIGYA
KQSLSCFLADLDLIMDVVPGDLVVNAMMAAMVAHSRGSSSEMAVYHVTSSMRHPAAYAVL
YRTGWRYFLENPRVGKDGVAVRTRPVYFFRTIASFRAFMAVAYALPLQLLRLLSLLCFGL
LFARRYADLSRKYSFVMQLVDLYGPFALFKACFDDLNMEKLRLSMATPPSSAAAALFNLD
PKNIDWDDYFYRIHIPGVMKYVLNK
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggttggcacaatggatgaagcgaggatcattgaatatttcaagaacaagagcatcctc
atcactggatcaacaggctttcttggaaagatactggtggagaagatactgagggttcag
cctgatgtcaggaagatctatctccctgtgagagcggtggatgcagctacagctaagcaa
cggatgcagactgaggtgatagggaaggagctgtttgggcttctgaaggagcagcatggc
aaggggtttcagtctttcatcgatgaaaaggtagttccattggctgcagacatgatgcat
cagaacctgggcctcgaggaatccaccttgcaagagctcgccaaggaccttaacatcatc
gtcaatggagctgccaccaccaacttctacgaaaggtacgacgtggctctggatgtgaac
gtgatgggggtgaagtacctgtgccagcttgccaagaagtgtgccaatctcgaggtgttc
ctccatgtctccacagcgtacgtgtgtggcgagaggtccggggtggtgcaggagagggcg
ttgagggagggggagacgctgcgggaggggacgtacctggacatcgagacggagctgcgg
ctggtgggcgagcagaggcagcagctggaggacgccggcgacgccaaggcggagaggaag
gcgatgaaggatctgggtttagccagggcgcgccacttcgggtggcccaacacctacgtg
ttcaccaaggccatgggggagatgatgcttcaggagcagctggtcgccggcgccggccgc
cgccacgggatccccgtggtgatcgcccgccccagcatcatcaccagcgtccacagggac
cctctccccggctggatcgagggcacccgcaccatcgacgccatcatcatcggctacgcc
aagcagagcctctcctgcttcctcgccgacctcgacctcatcatggacgtagtgcctggt
gacctggtggtgaacgcgatgatggcggcgatggtggcgcactcgagggggtcatcgtcg
gagatggcggtgtaccacgtgacgtcgtcgatgcggcacccggcggcgtacgcggtgctg
taccggacggggtggcgctacttcctggagaaccctagggtggggaaggacggggtggcg
gtgcgcacgcggcccgtctacttcttccgcaccatcgcctccttcagggcgttcatggcg
gtggcctacgcgctccccctccagctcctccgcctcctctccctcctctgcttcggcctc
ctcttcgcccgccgctacgccgacctctcccgcaagtactccttcgtcatgcagctcgtc
gacctctacggccccttcgccctcttcaaggcctgcttcgacgacctcaacatggagaag
cttcggctgtccatggccacgccgccgtcgtccgccgccgccgccctcttcaacctcgac
cccaagaacatcgactgggacgactacttctacaggatccacatccccggcgtcatgaag
tacgtcctcaacaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267826
Entry
9267826           CDS       T01015                                 
Name
(RefSeq) fatty acyl-CoA reductase 1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00073  Cutin, suberine and wax biosynthesis
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    9267826
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    9267826
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     9267826
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase 3Beta_HSD Polysacc_synt_2 GDP_Man_Dehyd RmlD_sub_bind Semialdhyde_dh DUF5571
Other DBs
NCBI-GeneID: 9267826
NCBI-ProteinID: XP_015648912
UniProt: B7F9S3 A0A8J8YHF9
LinkDB
Position
8:12115562..12121319
AA seq 496 aa
MISQMDSGNVVAFFRGRSILITGSTGFLGKVLVEKILRVQPDVKKLYLLVRANDVESATR
RVQDEVTGKEIFQVLKEKHGDGFESFVEEKVCTLAGDIIYENLGLDSAKLTELSNEIDII
VNGAATTNFYERYDVAFDSNVLGAKNICEFAKKCTKLKMLLHVSTAYVAGEQEGLILEKP
FLMGQALREGRHLDITSELNLIKETRREMKASNRCSEKTEKRTMKELGLKRAKHFGWPNT
YVFTKAMGEMLLGHLRGDLPVVIIRPSIITSILKEPLPGWMEGIRTIDSVIIGYAKQTLS
FFLVDLNLIMDVIPGDMVVNAMMVAMAAHSGEQAQTIYHVTSSLSNPAPYAVLSDAGHRY
FFANPPPRAGKNGRLRRMRFFSTVASFRAHMAINYKLPLEILRLVNIALCGMFSRRYDEL
SRKYKFVMHLVELYAPYTLFKGCFDDINTEKLRITMRKQEDKNDGGYCFDFDPKSIDWDE
YFYKVHIPGVVKYLCD
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgatcagccagatggattctggaaatgttgtagcgttcttcaggggcaggagcatcctg
atcaccggttcaaccgggttccttggcaaagtgcttgtggagaagatactcagggttcag
ccagatgtcaagaagctctacctcctggtccgggcaaacgacgtcgaatccgcgacgcgc
cgggttcaggacgaggtgacagggaaggagatctttcaagttctgaaagaaaagcatggt
gatgggttcgaaagtttcgtggaagaaaaggtctgtactttggcaggggacataatctat
gagaacttgggactagattctgccaaattgacagaattgtcgaacgaaatcgacatcatc
gtcaatggtgctgcgactacaaatttttatgaaagatatgatgtggcttttgactcgaat
gtcttgggagctaagaacatctgtgaatttgcgaagaagtgtacaaaactgaagatgctg
cttcatgtttcgactgcctatgtcgctggagaacaagagggactgatactagagaaacca
ttcttgatgggtcaagcactaagggaaggcaggcatttggatatcacatccgagctaaac
ctgatcaaggagaccaggagagagatgaaagctagtaaccgttgttcagagaagactgag
aagagaacaatgaaggagcttgggctcaagagggctaagcattttggatggccaaacacc
tacgttttcaccaaggcaatgggggagatgctgctggggcacctccgcggggaccttccg
gtggtgatcatccggccgagcatcataaccagcatcctcaaggagccattgcccggatgg
atggaaggaatcaggacgatcgactcggtgatcataggttacgccaagcagacactgtcc
ttcttcctcgtcgacctcaacctcataatggacgtgataccgggggacatggtggtgaac
gcgatgatggtggcaatggcggcgcactccggggaacaggcgcagaccatctaccacgtg
acgtcgtcgctgagcaacccggcgccgtacgcggtgctgtcggacgccggccaccgctac
ttcttcgccaacccgccgccgcgcgcggggaagaacgggcggctgcgcaggatgcgcttc
ttcagcacggtggccagcttccgcgcccacatggccatcaactacaagcttcccctcgag
atccttcggctggtgaacattgcgctctgtggcatgttctcccggcgctacgacgagctg
agcaggaagtacaagttcgtcatgcatctcgtcgagctctacgcgccctacaccttgttc
aaaggctgcttcgacgacatcaacacggagaagctaaggattacgatgaggaagcaggag
gacaaaaacgatggaggatattgttttgattttgaccccaagtcgattgattgggatgag
tatttctacaaggtccacatccccggtgtagtcaagtatctgtgtgattga

DBGET integrated database retrieval system