KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276326
Entry
107276326         CDS       T01015                                 
Name
(RefSeq) putative 4-coumarate--CoA ligase-like 8
  KO
K10526  OPC-8:0 CoA ligase 1 [EC:6.2.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    107276326
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-
     107276326
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 107276326
NCBI-ProteinID: XP_015646065
LinkDB
Position
7:complement(26605337..26611528)
AA seq 584 aa
METELHLAAGYCAATGVYRSGHPPQFAAAAALSFPEYILPHMLLPGRRARPAFVDASTGA
ALSFAGLRALSLRVARALAAAGLRRGRVALLLSPNSLHFPALSLAVLSLGAVLSAANPLL
TPDELARQADDAKPFLALVTGELAPKLRSIAPDVKLVLVEQLLADVAAEVDDDETLDLPA
ANIGRDDAALLFYSSGTTGRSKGVVSTHGNAIAMAASLERAWGGGGGGGEKPQQYDDHDE
AYGCVLPMFHMFGFSSFVMGTAALGATAVVVPGRFSVEKTMAAVEEYGVTRLLVVPPMVV
KMVAAAAGDGEPSRRRLRLRQVVSSGAPLQREHMARFRSCFPAVNLGQCYGLTETTGIVT
MCDLQHNDNGIDKVEMPPSSTDMTFVAVAATTTEAKIVDPDSGELLPPRRTGELWVRGPS
TMRGYLNNEEATALALVAAAGSVSVSGGGERWLRTGDLCYVDSRGLVYVVDRVKELIKCN
AYQVAPAELEDVLATHPDIHDAAVAPYPDKEAGEIPMAYVVKKQGSGHLQEDEVISFVQN
KVAPYKKIRKVVFVDSIPRSPSGKILRRQLKNLLQGSILHRSRM
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggagacggagttgcacctcgccgccggctactgcgccgccacgggcgtctaccggagc
ggccaccctccgcagttcgccgccgccgccgcgctctccttcccggagtacatcctcccg
cacatgctcctccccggccgccgagcccgcccggccttcgtcgacgcctccaccggcgcc
gcgctctccttcgccggcctccgcgcgctctcgctccgcgtcgcgcgcgcgctcgccgcc
gccggcctccgccgcggccgcgtcgcgctcctcctgtcgccgaactcgctccacttcccc
gcgctctcgctcgccgtgctctccctaggcgccgtgctctccgccgccaacccgctcctc
acgcccgacgagctcgctcggcaagccgacgacgcgaagcctttcctcgcgctcgtcacc
ggcgaactcgcccccaagctccgctccatcgcgcccgacgtcaaacttgtcctcgtcgag
cagctcctcgccgacgtcgccgcagaggtcgacgacgacgagacattggatctgccggcg
gcgaacattggccgcgacgacgcggcgctgctgttctactcgtcggggacgacggggagg
agcaagggcgtggtgagcacgcacggcaacgcgatcgccatggccgcgtcgctggagcgc
gcgtggggtggcggcggcggcggcggcgagaagccgcagcagtacgacgaccacgacgag
gcgtacggctgcgtgctgcccatgttccacatgttcggcttctcgtcgttcgtgatgggg
acggcggcgctgggcgccacggcggtggtggtccccggcaggttctcggtggagaagacg
atggcggcggtggaggagtacggggtgacgaggcttctggtcgtgccgccgatggtcgtg
aagatggtcgcggcggcggccggcgacggcgagccgtcgcggcgtcgtctccggctgcgg
caggtggtgtcgtccggcgcgccgttgcagcgcgagcacatggcgcgcttccgcagctgc
ttcccggcggtcaacctcggccagtgctacgggctaacggagacgacgggcattgtcacc
atgtgcgatctgcagcacaacgacaacggcatcgacaaggtggaaatgccaccgtcatcg
acggatatgacgttcgtcgctgttgcagcgacgacgacggaggccaagatcgtggacccg
gactccggcgagctcctcccgccccgccgcaccggcgagctctgggtccgaggcccctcc
accatgcgaggctacctgaacaacgaggaggcgaccgccctggccctggtcgccgccgcc
ggctctgtctccgtctccggcggcggcgagcggtggctgcggaccggtgacctgtgctac
gtggactcgcgtgggctggtgtacgtggtagacagggtgaaggagctgatcaagtgcaac
gcctaccaggtggctccggccgagctggaggacgtcttggccacccaccctgacatccac
gacgcagccgtcgcgccgtatcccgacaaggaggccggcgagatcccgatggcatatgtg
gtcaagaaacaaggcagcggccatcttcaggaagatgaagtcatttcctttgtacagaac
aaggtggcgccatacaagaagatcaggaaagtggtgttcgttgactccattccaaggtct
ccttcaggcaaaatcctcaggcgccagctgaaaaacttgctacaggggtctatcctgcat
cgaagcaggatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331515
Entry
4331515           CDS       T01015                                 
Name
(RefSeq) 4-coumarate--CoA ligase-like 4
  KO
K10526  OPC-8:0 CoA ligase 1 [EC:6.2.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4331515
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-
     4331515
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4331515
NCBI-ProteinID: XP_015629747
UniProt: Q10S72
LinkDB
Position
3:1822230..1826042
AA seq 552 aa
MGRSPEMEVDARSGYCAATRTFRSRRADVPLPADPEVDVVSFLASRRHSGVVALVDAATG
RRITFTELWRAVAGAASALAAHPVSLRKGHVALILSPNSVHFPVAALAAMSLGAVLTTAN
PLNTPAEIAKQVADARPVLAFTTRELLPKLPRAHDLRVVLLESARLPGDSSDPRIVATIE
EISATTPDPARRKDRVTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMTRFRLEGS
DKTETFLCTVPMFHVYGLVAFATGLLGCGATVVVLSKYELPEMLRSINAYGVTYLPLVPP
ILVAMVAHPKPLPLGQMRKVLSGGAPLGKELIEGFREKYPQVEILQGYGLTESTAIGAST
DSAEESRRYGTAGLLSPNTEAKIVDPDSGEALPVNRTGELWIRGPYVMKGYFKNAEATQS
TLTPDGWLKTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPEVTDVAVI
PFPDREVGQFPMAYIVRKKGSNLSEREVMEFVAKQVAPYKKVRKVAFVTDIPKNASGKIL
RKDLIKLATSKL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgggacgctcaccggagatggaggtggacgcgcgcagcggctactgcgccgccacccgc
acgttccggagcaggcgcgccgacgtgccgctgcccgccgacccggaggtcgacgtggtc
agcttcctcgcctcgcgccgccactcgggcgttgtggccctcgtcgacgccgcgactggg
cgccggatcaccttcaccgagctctggcgcgccgtggccggggcggcatccgccctcgcc
gcgcaccccgtctccctccgcaagggccacgtcgcgctcatcctctcccctaactccgtc
cacttccccgtcgccgccctcgccgccatgtcgcttggcgccgtcctcaccaccgccaac
ccgctcaatacccccgccgagatcgccaagcaggtcgccgacgcccgccccgtcctcgcc
ttcaccacccgcgagctcctccccaagctcccgcgtgcccacgacctccgcgtcgtcctc
ctggaatccgcccgcctccccggcgacagctccgacccgcggatcgtcgccaccatcgag
gagatctccgccacgacgcccgacccggcgcgccgcaaggaccgcgtcacgcaggacgat
ccggccaccctgctctactcctcggggacgacggggccaagcaagggcgtcgtcgccacg
caccggagcctcatctccatggtccagatcatcatgacgcgattccgcctcgagggctcg
gacaagacagagacattcctctgcacggtgcccatgttccacgtctacggcctcgtcgcc
ttcgccacggggctgctcggttgcggcgccacggtggtcgtgctctccaagtacgagctc
ccggagatgctgcgctcgatcaacgcctacggggtgacctaccttccgctcgtgccgccg
atcctggtcgccatggtggcgcacccgaagccgctcccgctcgggcagatgcgcaaggtg
ctatccggcggcgcgccgctgggcaaggagctgatcgaagggttcagggagaagtatccg
caggtggagatcctgcaggggtacgggctgacagagagcaccgccatcggcgcgtccacg
gactccgccgaggagagccgccggtacgggacggccgggcttctgtctcccaataccgag
gctaagattgtcgacccagattccggcgaggcgctgccggtaaaccgcaccggcgagctc
tggatccgtggaccgtacgtcatgaaaggctacttcaagaacgcagaggcaacacagtca
acgctgacaccagatggatggctaaagaccggtgatctctgctacatagatgaggatgga
tatctcttcgtagtggaccgcctcaaggagttgatcaaatacaaaggttaccaggtgcct
ccggcagaactggaagctcttttgttgacgcacccagaggttacggatgttgccgttata
ccgtttcctgatagggaggtcggccagttcccgatggcctatatagtgaggaagaaagga
agcaacttgtcagagcgcgaggtgatggagtttgtggcaaaacaggttgcgccttacaag
aaggttagaaaggtggcgtttgtgacggacattcccaagaatgcatccgggaagatactg
aggaaggatcttattaagcttgccacatccaaactatga

DBGET integrated database retrieval system