KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276344
Entry
107276344         CDS       T01015                                 
Name
(RefSeq) cysteine synthase, chloroplastic/chromoplastic-like
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    107276344
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107276344
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     107276344
SSDB
Motif
Pfam: PALP TFIIB
Other DBs
NCBI-GeneID: 107276344
NCBI-ProteinID: XP_015641579
LinkDB
Position
6:complement(21698208..21700482)
AA seq 302 aa
MKNIAKKEGIQARLVGKMEAYQPLFSVKDRTALGMVEDAEEKGLITPGVTTLIEPTGGNL
GTGLVLVAIQRGYRFIAVMPAGYSLDKQMLLRFLGAEVILTDPAGGFKGMMDKVEELTKV
MPNYHCFNQSINPANPDAHFKWTGPEIWKDTAGKVDIFVTAAGTGGTLSGVGRYLKMKNP
SINIVCVEPSESAVISGGSPGFHKIQGTGPGFIPENLDRSIIDEVVTVSSEESITMARRL
AKEEGLLVGISSGANVSACIKIAAREENKGKMIVTMLPSGGERYMNSDLFADVREECANM
TF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaagaacatcgccaagaaagaaggcatccaagctcgtttggttggaaagatggaagca
taccaaccccttttctcggtcaaggacagaactgctctcggtatggttgaagatgcagag
gagaaaggcttgattacacctggtgttacgacgctgattgaaccaactggtggtaatctt
ggtaccggtttggtattggttgctattcagagaggctacaggttcattgctgttatgcct
gctggatattcacttgacaagcagatgctactgaggtttttgggtgctgaagtgatatta
acagatcctgcaggtggattcaagggtatgatggacaaagtggaagagctcaccaaggtc
atgccaaattatcactgttttaaccaatcaattaacccagcgaacccagatgcacacttc
aaatggactggacctgagatctggaaggatacagccggcaaagttgatatctttgtaacc
gccgctggaacagggggcacactgtcaggtgtaggaaggtacctgaagatgaaaaatcca
tctataaatatagtgtgcgtggaaccttcagaaagcgctgtaatttcaggtggttcacca
ggttttcacaagattcaaggcactgggccaggtttcataccggaaaatttggatagatct
atcatcgatgaagttgtgaccgtaagctcggaggaatccataacaatggccagaaggctt
gcaaaggaggaggggctgcttgttggcatatcttctggtgcaaatgtgtctgcttgcatc
aagattgcagctagagaggagaacaagggtaagatgattgttacaatgctgccgagtggg
ggtgaaagatacatgaactctgatctctttgcagatgtaagggaggaatgtgctaatatg
accttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277031
Entry
107277031         CDS       T01015                                 
Name
(RefSeq) cysteine synthase-like
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    107277031
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107277031
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     107277031
SSDB
Motif
Pfam: PALP ADH_zinc_N Abhydrolase_3
Other DBs
NCBI-GeneID: 107277031
NCBI-ProteinID: XP_015641334
LinkDB
Position
6:complement(21708936..21727906)
AA seq 376 aa
MPYAIMGRSQAFPFSSFTLGRAPALVLSKRSKGKDGRVMATDQEEDGATEEEDARKGIPF
LLSSQEENIASDILQLIGWTPLIEMKKINASRRAAGVRLVGKMETYQPLCSVKDRTALGM
IEDAEKRGSISPGDTLIEATSGNLGIGLAAVAIQKGYKFIAVIPNSYPPDKQKLIKYLGA
EVRITGPYRNMEKKVEELKKSIKNSYNLDQMVNEANVEAHYKWTGPEIWKDTAGKVDIFV
TSVGSGGTLAGVGKYLKEKNQSIRIVAVEPAESPVLSGGKASKHRIQGIGVGFETEILKA
HKPIITYEVKTIYSEDAITKARMLAREEGLLVGISAGANIAVCLELAAKEENKGKMIVTM
LPSGADRYLSSDLFKY
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgccctacgctattatggggagatctcaagcattcccgttttcgtcattcacattaggt
agagctcctgcccttgttttgagcaagcgatcaaaaggtaaagatgggcgagttatggca
acagatcaggaagaagatggggcaacagaggaagaagatgcaaggaaaggcatcccgttt
ctgctttcgtcccaagaagagaacatcgcctcagacatcctgcagctgataggatggaca
ccactgatagaaatgaagaagattaatgctagcagaagggctgcgggagttcgtttggtc
gggaagatggaaacataccaacctctttgttcagtcaaagacaggactgcccttggtatg
atagaagatgctgaaaagaggggctcgatttcacccggagatacactaatcgaggcaaca
agtggtaaccttgggattggtttggccgctgttgctattcagaaaggttacaaatttatt
gctgtaatccctaatagctatccacctgataagcagaagttaataaagtatttgggcgcc
gaagtaagaataactggtccatataggaatatggagaaaaaggtggaggaacttaaaaaa
agtataaaaaattcttataatcttgatcagatggtcaatgaagcaaacgtagaggcacat
tataagtggacaggacctgaaatttggaaagatacagcaggcaaagtggatatttttgtg
acgtctgtcggttcagggggcacattagcaggagtaggaaagtacctaaaggagaaaaac
caatctataaggatagtcgccgtggaacctgcggaaagccccgtactgtcaggtggcaaa
gccagcaagcacaggatccagggcataggggtgggttttgaaacagaaattttgaaggca
cataaacctattattacctatgaagtgaagacaatatatagtgaggatgccataacaaaa
gcgaggatgctggccagggaggaggggttgcttgttggtatttctgctggcgcaaatata
gctgtttgcttggagcttgcggcgaaagaggagaacaaggggaagatgatcgtcaccatg
ctcccaagcggcgccgacagatacctaagctccgatctcttcaagtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327819
Entry
4327819           CDS       T01015                                 
Name
(RefSeq) cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4327819
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4327819
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     4327819
SSDB
Motif
Pfam: PALP ADH_zinc_N
Other DBs
NCBI-GeneID: 4327819
NCBI-ProteinID: XP_015619253
UniProt: B9EX17 Q5JNB0
LinkDB
Position
1:complement(43232032..43238506)
AA seq 394 aa
MASWSSPVAAAALQVHFGSSCFFSARSPRQTLLLPPLARNPTLTIQPRPHPFRNINSSSS
SSWMCHAVAAEVEGLNIADDVTQLIGKTPMVYLNNIVKGCVANVAAKLEIMEPCCSVKDR
IGYSMISDAEEKGLITPGKSVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSMERRVL
LKAFGAELVLTDAAKGMKGAVDKATEILNKTPDAYMLQQFDNPANPKVHYETTGPEIWED
SKGKVDVFIGGIGTGGTISGAGRFLKEKNPGIKVIGIEPSESNILSGGKPGPHKIQGIGA
GFVPRNLDSEVLDEVIEISSDEAVETAKQLALQEGLLVGISSGAAAAAAIKVAKRPENAG
KLVVVVFPSFGERYLSSILFQSIREECEKLQPEP
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggcgtcgtggtcgtcgcccgtcgccgccgccgccttgcaggtccatttcgggtcctcc
tgcttcttctccgcccgatcgccacgacagaccctcctcctaccacctctcgcccgcaac
cctacactgaccatccagccccggccccatcccttccggaacatcaactcctcctcctcc
tccagctggatgtgccacgccgtcgccgccgaggtcgagggcctcaacatcgccgacgac
gtcacccagctcatcggcaagactccaatggtatatctcaacaacatcgtcaagggatgt
gttgccaatgtcgctgctaagctcgagattatggagccctgttgcagtgtcaaggacagg
ataggatacagtatgatttctgatgcggaagagaaaggcttgataactcctggaaagagt
gttttggtggaaccaacaagtggaaatacaggcattggtcttgccttcattgctgcttcc
agaggatataaattaatattgaccatgcctgcatcaatgagcatggagagaagagttcta
ctcaaagcttttggcgctgaacttgtccttactgatgccgcaaaagggatgaagggggct
gtagataaggctacagagattttaaataagacacctgatgcctatatgctgcagcagttt
gacaaccctgccaacccaaaggtacattatgagactactgggccagaaatctgggaggat
tctaaagggaaggtggatgtattcattggtggaattggaacaggtggaacaatatctggt
gctggccgtttcctgaaagagaaaaatcctggaattaaggttattggtattgagccttct
gagagtaacatactctctggtggaaaacctggcccacataagattcaaggcattggggca
ggatttgttccaaggaacttggatagtgaagttctcgatgaagtgattgagatatctagt
gatgaggctgttgagacagcaaagcaattggctcttcaggaaggattactggttggaatt
tcatctggggcagcagcagcagctgccattaaagttgcaaaaagaccagaaaatgctgga
aagttggtagtggttgtgtttccaagctttggtgagaggtacctttcatctatccttttt
cagtcgataagagaagaatgtgagaagttgcaacctgaaccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332062
Entry
4332062           CDS       T01015                                 
Name
(RefSeq) cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4332062
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4332062
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     4332062
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 4332062
NCBI-ProteinID: XP_015631293
UniProt: Q10PZ5 Q0DTZ5
LinkDB
Position
3:6085628..6089048
AA seq 450 aa
MAAATAAAGAAAAVSLLACYLLLHRDGAKLPWVGPTTRSSRSSGRRTRRKGLVEAIGNTP
LIRINSLSDATGCEILGKAEFLNPGGSVKDRVAVKIIEEALESGDLLCGGTVTEGSAGST
AISLAIVAPAYGCKCHVVIPDDAAIEKSQIIEALGATVERVRPVSITHRDHFVNIARRRA
LEANKSAAAQRESRYKETNGSAHVNTRIMHSKITASKGESNKALTNCSANSEIQYNGKCD
HDSDSKGGFFADQFENMANYRAHYEWTGPEIWQQSKGTLHAFVAAAGTGGTIAGVSRYLK
EKNTNIKCFLMDPPGSGLFNKVTRGVMYTKEEAEGKRLKNPFDTITEGIGINRVTKNFMM
AELDGAYRGTDREAVEMSRFLLKNDGLFVGSSSAMNCVGAVRVAQDLGPGHTIVTILCDS
GMRHLSKFFNDQYLANHGLTPTATGLEFLD
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggcggctgcgacggcggcggcgggagcagccgccgccgtatccctgctcgcgtgctac
ctcctcctacacagggacggcgccaagctgccgtgggtcgggcccacgacgaggtcctcc
cgctcgagcggccggcggacgcggcggaagggcctcgtggaggccatcggaaacacgccc
ctcatccgcatcaacagcctctccgacgccacagggtgcgagatcctggggaaggccgag
ttcttgaatcccggaggcagcgtgaaggaccgtgtggcagttaagatcatcgaagaggct
ctggaatctggtgatcttctctgtggtggtacagtaacagaggggagtgctggaagcaca
gctattagcttggccattgttgctcctgcttatggctgcaaatgtcatgttgttattcct
gatgatgctgccattgagaagtctcaaataatcgaggcgctcggggctacagttgaacga
gtgcgccctgtttcaattacacatagggaccattttgtcaatattgctagaagaagggct
ttagaagcaaacaaatcagcagcggcccagagagagtcaaggtacaaagaaactaatggt
tcagcgcatgtcaatactagaataatgcacagcaagataacagcaagcaaaggggagtca
aacaaggcactaactaactgttcagccaattctgaaatacaatataacgggaagtgtgat
catgactctgattcaaagggaggtttctttgctgaccaatttgagaatatggcaaactac
cgagcccattatgaatggactggtcctgagatatggcaacaaagtaaagggacactgcat
gcctttgttgctgcagctggcactggtggcacaattgctggagtctcacggtatcttaag
gaaaagaacacaaacatcaaatgcttcttaatggacccacctggatctggtctgttcaat
aaggttactagaggggtgatgtacacaaaagaggaagctgagggcaaaaggctgaagaat
ccttttgacactattactgaaggaattggaatcaacagggttacaaaaaattttatgatg
gcggaactggatggagcttaccggggaacagatagggaagctgttgagatgtcaaggttc
ttgttgaaaaatgatgggctgttcgttgggagttcttcagccatgaattgtgttggtgct
gtaagagttgctcaagatttaggtccaggacatacaattgtgacaattctctgtgacagt
gggatgaggcatctaagtaagttcttcaatgaccaatatttggctaaccatggcctgaca
ccaacagctaccggtctggaatttcttgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334101
Entry
4334101           CDS       T01015                                 
Name
(RefSeq) cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4334101
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4334101
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     4334101
SSDB
Motif
Pfam: PALP ADH_zinc_N
Other DBs
NCBI-GeneID: 4334101
NCBI-ProteinID: XP_015633055
UniProt: Q9XEA8
LinkDB
Position
3:30760009..30763678
AA seq 325 aa
MAESGQSIASDVTALIGNTPLVYLNKVVDGCEAQIAAKLEIMEPCSSVKDRIGYSMITDA
EEKGLITPGKSVLIEPTSGNTGIGLAFMAAAKGYKLILTMPASMSMERRIILKAFGAELV
LTDPLLGMKGAIQKADELAAKMPNSYILQQFENPANPKIHYETTGPEIWKATAGKVDILV
SGIGTGGTVTGTGKYLKEQNPEIKIYGVEPTESAILSGGRPGPHKIQGIGAGFVPGVLDV
NLLDEVVQVSSDEAISMAKQLALKEGLLVGISSGAAAVAAIRVAQRPENKGKLVVVVFPS
FGERYLSSVLFESIKREAENMVFEP
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggaatcaggccaatcgattgcgagtgatgtgactgcactgatcggcaatactccc
ctggtgtacctgaacaaggtggtggatggatgtgaggcccaaatcgctgccaagcttgag
atcatggagccctgctccagtgtcaaggataggattggttatagcatgattacagatgca
gaagagaagggtctcattactccaggaaagagtgttttgattgagcctactagtggaaat
actggtattggccttgctttcatggctgctgccaagggttataagctaatcctgacaatg
ccagcatccatgagcatggaaaggaggatcattcttaaggccttcggtgccgagttggtc
cttaccgatccacttctgggcatgaaaggtgcaatccagaaggcagatgagctggcagca
aagatgcctaactcttacattctccagcagtttgagaaccctgcaaacccaaagatccac
tatgagacaactggacctgagatttggaaggccactgctgggaaagttgatatccttgtc
tctggcattggaaccggtggtacagtaaccggaacaggaaagtacctcaaggagcagaac
cctgagatcaagatctatggtgttgaaccgacagaaagtgcaattttatctggaggaaga
cctggtccacacaaaatccaaggtataggtgctggttttgttcctggtgtacttgatgtc
aatctcctggatgaagtggtccaagtctcaagtgatgaagccatcagcatggcgaagcag
ctagcgttgaaagaagggctgctggttgggatctcatctggtgctgctgcagtcgctgcc
atcagggtcgcgcagcggcccgagaacaaagggaagctcgtagttgtggtcttcccgagc
ttcggtgagcgctacctgtcgtctgtcctcttcgaatcgatcaagagggaggccgaaaac
atggtgttcgagccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335048
Entry
4335048           CDS       T01015                                 
Name
(RefSeq) bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial isoform X1
  KO
K13034  L-3-cyanoalanine synthase/ cysteine synthase [EC:2.5.1.47 4.4.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00460  Cyanoamino acid metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4335048
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4335048
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4335048
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     4335048
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.9  L-3-cyanoalanine synthase
     4335048
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 4335048
NCBI-ProteinID: XP_015636260
LinkDB
Position
4:complement(4457456..4461839)
AA seq 384 aa
MERALMSLMRRRSLLQSGGRAPPAMAAAAGGSPFFSTLQQAAAADPVQSPGILPGLKIRD
SASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKKGLITPGK
TTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKLVLTDPTKGMGG
TVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMGIGSGGTVT
GVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPEILNMDIMEKVIEVK
GEDAVKMARELALKEGLLVGISSGANTVAALELAKKPENKGKLIVPMRLFFQTVLPSLGE
RYLSSALFEELRAEAEAMQPVPVD
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggagagggctctgatgagcctcatgaggcggcgctccctcctccagagcggcggacga
gcaccgccggcgatggccgccgccgccggtggctcaccattcttctccaccctgcagcaa
gcagccgccgcagacccggtccagtcgcctggcatcttgccagggctcaagatcagggac
tctgcgtcacagctgattgggaggacacccatggtttacctgaacaaggtcactgaagga
tgtggggcccggattgctgctaagctcgagttcttgcagccgtccttcagcgtcaaggac
agaccagcaatttcaatgttggaagatgctgaaaagaaggggttgatcaccccaggtaag
accacactgatcgagccgacatcagggaacatgggtattggcctggcattcatggctgct
cttaaagggtatgaactcatactcacaatgccttcatacaccagccttgagaggagggtg
accatgagggccttcggcgcaaaactcgtccttaccgacccaacaaaaggtatgggaggc
acggtgaggaaggccgccgagctgtatgagaaccatcctagcgcgttcatgctgcagcag
tttgagaatcctgcaaatgtcaaggtacactatgagacaactggtccagaaatctgggag
gatacacttgggcaggttgatatttttgtcatgggaatcgggagcggcggcaccgtcact
ggtgttggcaagtatcttaaggagaagaaccccaatgcaaagatctatggagttgaacct
gctgaagcaaatgttttgaatggtggcaaaccaggtcctcacctcatcactggaaatgga
gtgggatttaagccggaaattttgaatatggatataatggaaaaggttattgaggtgaaa
ggtgaggatgctgttaagatggctcgagaattggcactgaaggagggtcttctggttgga
atatcatcaggagctaacacagttgctgctcttgaactagcaaagaagccagaaaacaaa
gggaagctcattgtgccaatgcgacttttttttcagactgttcttccgagtttaggggag
agatacctgtcatctgcattgtttgaggaattgagagcggaggctgaggccatgcagcca
gtgccagtggactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340140
Entry
4340140           CDS       T01015                                 
Name
(RefSeq) cysteine synthase-like
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4340140
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4340140
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     4340140
SSDB
Motif
Pfam: PALP Abhydrolase_3 TFIIB
Other DBs
NCBI-GeneID: 4340140
NCBI-ProteinID: XP_015642972
UniProt: A3B8F2 Q9XEA9 Q5VND3
LinkDB
Position
6:2574175..2576716
AA seq 339 aa
MEEGGRRGIPSLLNSSSSDEHIATDITQLVGWTPLIELNRIVRKDGVNARIVGKLESYQP
LCSVKDRSALRMIEDAEEKGLISPGVTTLVEPTSGNLGIGVAYNALLKGYRFVAVMPAEY
SLDKQMLLTYLGAEVILTDPTLGFQGQLDKVEQIKNDMPNVHHLDQFKNAANPEAHFVWT
GPEIWKDTAGKVDIFVAGSGTGGTISGVGKYLKMKNPAVKVICVEPAESPVISGGKPSRH
KIQGMGPGFVPKNLDISIVDEIITVTAQDAMANAKRLAREEGLLVGISSGANLAACLKVA
SRKEYEGKMIVTIFPSGGERYMNSDLFAQAREECSAMTF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaggaaggaggcaggagagggatcccttctctgctaaattcatcgtcatcagatgaa
catatcgccactgatatcactcagcttgtaggatggacgccactgatagagctgaaccgg
atcgtccgaaaagacggggtaaatgcccggattgttggcaaattggagtcataccaaccc
ctctgctctgtcaaggatcgcagtgctctgagaatgattgaggatgcagaggagaaaggt
ctgatctcaccaggcgttacgacgctagtcgagccgacaagtggtaatcttggaataggt
gtggcatacaatgctctgctcaaaggttacaggttcgttgcagtcatgcctgctgagtat
tcacttgataagcaaatgttgttgacgtatctaggggccgaggttattttaactgatcct
acacttggttttcagggacaattagacaaagttgaacagatcaagaatgatatgcctaac
gtacatcatcttgatcagtttaaaaatgcagcaaatcctgaagcacactttgtatggaca
gggcctgagatttggaaggatacggcaggcaaagtagatatctttgtggctggttctggc
acaggaggaacaatttcaggtgtagggaaatatttgaagatgaaaaacccagcagttaaa
gtaatttgtgttgagcctgcggaaagccctgtaatttcaggtggtaagccttcgcggcat
aaaattcagggaatgggtccaggctttgtaccaaaaaacctggatatctcaatcgtcgat
gagatcatcacagtaactgcacaagatgcaatggctaatgcaaagaggctggcaagagaa
gagggtttacttgtgggcatatcatccggagctaatttggcagcttgtctgaaggtggca
tcgaggaaagaatatgagggaaagatgattgtaaccattttccctagtggtggtgaaaga
tacatgaactctgacctctttgcacaagcaagggaggagtgcagcgccatgaccttttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340142
Entry
4340142           CDS       T01015                                 
Name
(RefSeq) cysteine synthase-like
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4340142
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4340142
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     4340142
SSDB
Motif
Pfam: PALP Abhydrolase_3 TFIIB Tubulin_2
Other DBs
NCBI-GeneID: 4340142
NCBI-ProteinID: XP_015642974
UniProt: Q5VND2 B9FRI2
LinkDB
Position
6:2579039..2581727
AA seq 347 aa
MEGEGIGRRGLPSLLGSSSSESGGIGQEHIASDITQLIGWTPLVELKRIASKDGIDARIV
GKVEAYQPLCSVKDRSALRMIEDAEEKGLITPGVTTLVEPTSGNLGLGLVLVALRKGYRF
VAVMPGQYSFDKQILLKYMGAELFLSDPTLGFQGLVDKVEQLKKELPNVHVLNQFSNPAN
QEAHMRLTGPEIWKDTAGKVDIFVTGSGSGGTVSGVGKYLKLQNPAVKIICVEPAESPVI
SGGEPGKHKIQGIGPGLIPDMLDTSVIDEVVTVNTDEAMVNARRLAMEEGLLMGISSGAN
LAACLKVASREENKGKMIVTMFPSGGERYMNSDLFAAVREECNAMTF
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagggagaggggattgggaggagaggccttccttcactgctcggttcctcttccagc
gaaagcggcggaatcgggcaagaacacattgcctctgacatcacgcagctcataggatgg
acgccactggtcgagctgaagcgaatcgccagcaaggacggaatagatgcccggatcgtc
ggcaaggtcgaggcctatcagcccctctgctccgtcaaggatcgcagcgctttgagaatg
atcgaggatgcagaagagaaagggctgattactcctggtgtcacaactctagtcgagccg
acgagtggcaatctgggtttaggattggtgcttgttgctcttcgcaaaggttacaggttc
gttgcagttatgccgggccagtattcgtttgataagcagatcttgctgaaatacatggga
gctgaattgtttctatcagatccaacactcgggtttcaaggcttagtcgacaaggtcgaa
cagctcaagaaagaattacccaatgtgcacgttcttaatcaattctcaaatccagcaaat
caggaggcacacatgagattgactggacctgagatttggaaggatactgctggcaaggta
gacatatttgttaccggttcgggctcaggaggtacggtatctggcgttggaaagtatctc
aagctgcaaaatccagcggtgaagatcatttgtgtggagcctgcagagagcccagtcatt
tcaggtggggagccaggtaaacataaaattcagggaatagggccaggactcatacctgat
atgttggacacctcggtcatcgatgaagtcgtcacggtaaacactgatgaagcaatggtg
aatgcaaggaggctggcaatggaagagggcctccttatgggcatttcttctggggcaaac
ctggcagcttgcttgaaggtcgcgtcgagagaggaaaacaaggggaagatgattgtcacc
atgttcccaagcgggggtgagaggtacatgaactctgacctctttgcagctgtgagagag
gaatgcaatgccatgacattttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341321
Entry
4341321           CDS       T01015                                 
Name
(RefSeq) cysteine synthase-like
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4341321
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4341321
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     4341321
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 4341321
NCBI-ProteinID: XP_015641630
UniProt: Q0DBH5 Q5Z8Y9 Q9XEA7
LinkDB
Position
6:complement(21700495..21703460)
AA seq 357 aa
MGEEIKNGEEGPDMAAPGEEEQEQGRKGIPSLLSSREENIASNITQLIGWTPLVEMKNIA
KNEGVQARLVGKMEAYQPLCSVKDRSALRMIEDAEEKGLITPGVTTLIEPTSGNLGIGLV
LVAVQKGYRFIAVMPAKYSLDKQMLLRFLGAELILTDPAIGFNGMMDKVEELMKSIPNSH
CLNQVTNPANPEAHFMWTGPEIWKDTAGKVDVFVASVGSGGTLTGVGRYLKMKNPSINIV
CVEPSESPVISGGSPGPHKIQGTGAGFIPEILDKSVIDEVVTVNTEESMAMARRLAKEEG
LLVGISSGANVAACIKIADREENKGKMIVTMFPSGGERYMNSDLFAPVREECDNMTF
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgggggaagaaatcaagaacggagaggagggaccagacatggctgcaccgggcgaggag
gagcaggagcaggggaggaaaggcatcccgtctctgctctcctccagggaggagaacatc
gcctctaacatcactcagctgattggatggacaccgcttgttgagatgaagaacatcgcg
aagaacgaaggcgtacaggctcgattggttgggaagatggaagcataccagccactctgc
tctgtcaaggacaggagtgccctcagaatgattgaagatgcagaggagaaagggttgatc
acacctggtgttaccacgctgattgagccaacgagtggtaatctcggtatcggtttggtg
ctggttgctgttcagaaaggctacaggtttattgctgtcatgcctgctaaatattcgctt
gacaagcagatgctactgaggtttttgggtgctgaattgatattgacagatcctgcaatt
gggtttaatggtatgatggacaaggtggaagagctcatgaagagcataccaaattctcat
tgtctcaatcaagtaacaaacccagcaaatccagaggcacactttatgtggactggacct
gaaatatggaaagacacagccggcaaagtggatgtgtttgtggcctctgttggttcaggt
ggcacattgacaggtgtagggaggtatctgaagatgaaaaatccatctataaatattgtg
tgcgtggaaccttcagaaagccctgtaatttcaggtggttcaccagggccacacaagatt
caaggcactggggcaggtttcatacctgaaattttggacaaatctgtcatcgatgaagta
gtgacagtaaacacagaggaatccatggcaatggcgaggaggctggcgaaggaggaagga
ttgcttgttggcatatcttctggtgcaaatgtagctgcttgcatcaagattgcagacaga
gaggagaacaaggggaaaatgattgtgacaatgttcccgagcggcggtgaaagatacatg
aactctgatctctttgcacctgttagagaggaatgtgataatatgaccttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341322
Entry
4341322           CDS       T01015                                 
Name
(RefSeq) cysteine synthase-like
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4341322
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4341322
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     4341322
SSDB
Motif
Pfam: PALP TFIIB Abhydrolase_3
Other DBs
NCBI-GeneID: 4341322
NCBI-ProteinID: XP_015641977
UniProt: Q0DBH4 Q5Z6A9
LinkDB
Position
6:complement(21730429..21733680)
AA seq 342 aa
MAAEVEEGRTGIPSLLSSAVGEETIASNIAQLIGWTPLIEMKNIPKKEGIQTRLIGKMET
YQPLFSVKDRTALSMIEDAEEKGLITPGVTTLIEPTSGNLGIGLVLVAIQKGYRFIAVMP
ARYSPDKQMLLRFLGAELILTDPAGGYKGAMDKVEDLMKIMPNYHCFNQATNPANPEAHF
KWTGPEIWKDTAGKVDFFVTAAGTGGTLSGVGRYLKIKNPSINIVCVEPSESAVISGGSP
GSHKIQGTGPGFIPKTLDRSIIDEVVTVSSEESMAMARRLAKEEGLLVGISSGANVAACI
KIAAREENKGKMIVTMFPSGGERYMSSDLFADVREECANMTF
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcggctgaggtggaggaggggaggacgggtatcccgtctctgctctcctccgccgtg
ggggaggagaccatcgcctccaacatcgcccagctgataggctggacgccactgattgag
atgaagaacatccccaagaaagaaggcatccaaactcgtttgatcgggaagatggaaaca
taccaacccctgttctcggtcaaggacagaactgctctcagtatgattgaagatgcagag
gagaaaggcctcattactcccggtgttacgacactgattgaaccaaccagtggcaatctt
ggtatcggtttggtattggttgctattcagaaaggctacaggtttattgctgttatgccc
gctagatattcacctgacaagcagatgctattgaggtttttgggtgctgaactgatatta
acagatcctgcaggtgggtacaagggtgcgatggacaaagtggaagatctcatgaagatc
atgcctaattatcattgttttaatcaagcaaccaacccagcaaatccagaggcacatttc
aaatggactggacctgaaatttggaaggacacagccggcaaagttgatttctttgtaacc
gcagctggaacaggaggcacattgtcaggtgtaggaaggtacctgaagatcaaaaatcca
tctataaatatagtgtgcgtggaaccttcagaaagtgctgtaatttcaggtggttcacca
ggatcacacaagattcaaggcactgggccaggtttcataccgaaaactttggacaggtcc
atcatcgatgaagttgtgaccgtaagctcagaggaatccatggcaatggcaagaaggctt
gcaaaggaagaggggcttcttgttggcatatcttctggtgcaaatgtagctgcttgcatc
aagattgcagctagagaggagaacaagggtaagatgattgttacgatgttcccgagtggt
ggtgaaagatacatgagctctgatctctttgcagatgtaagggaggaatgtgctaatatg
accttctaa

DBGET integrated database retrieval system