KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276351
Entry
107276351         CDS       T01015                                 
Name
(RefSeq) probable calcium-binding protein CML22 isoform X1
  KO
K13448  calcium-binding protein CML
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107276351
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_4 Pan3_PK IMD DUF6184 FBPase_glpX
Other DBs
NCBI-GeneID: 107276351
NCBI-ProteinID: XP_015639799
LinkDB
Position
5:complement(2716766..2718616)
AA seq 267 aa
MIASGNVPSSSLELHSNLHNNIAYHFISQLQNFIAEMGCVESKLVATIKYRRVEKDLDKK
VAEALKERTKSKKKTFRSVNSITMGLPRFKEGLRNIRDVFDQYDEDSNGTIDNEELRNCL
NKLQVQMSEEEIDNIHRYCDIDNRKGIQFPEFVVFLCLMYLLFGSDVTYRVSEFESARLN
YVFDELIDAFLFFDKDGNGKMKRKDVTQRMNEATHQERTPSHITSQLFKEMDLNRNGHVN
LKEFLLSIIRWAGVETDDDEARNETSP
NT seq 804 nt   +upstreamnt  +downstreamnt
atgattgcatcaggaaacgtcccatctagctctctcgagctgcacagcaatttgcacaac
aatattgcttaccacttcatctcccagctgcagaatttcatagcagagatgggatgtgta
gaatccaagctggttgctactatcaagtacaggagagtggagaaggatcttgacaagaag
gtggctgaggcgctcaaggagaggaccaagtcgaagaagaagaccttcaggtcagtgaac
agcatcaccatgggtctccctcgcttcaaggagggcctcaggaacatcagggatgtcttc
gaccaatatgatgaggactcaaatgggacaattgacaatgaggagctgaggaactgcctg
aacaagcttcaggtccagatgtcagaggaggagatcgacaatattcatcgctactgcgac
atcgacaacaggaaggggatccagttcccggagttcgtcgtcttcctctgcctcatgtac
cttctttttggttcagatgtcacataccgtgtttcagagtttgaatccgccaggctcaac
tatgttttcgatgagctcatcgacgccttcctgttcttcgacaaggatggaaatggcaag
atgaagaggaaagatgtaacccagaggatgaatgaggctactcatcaggagaggaccccc
agccacataacgtcacagctattcaaagagatggacctgaacaggaatggccatgtgaac
ctgaaggagtttctcttatcaattatcagatgggcaggagttgagactgatgatgatgaa
gcaagaaatgagacttctccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276719
Entry
107276719         CDS       T01015                                 
Name
(RefSeq) putative calmodulin-like protein 6
  KO
K02183  calmodulin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04070  Phosphatidylinositol signaling system
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107276719
   04070 Phosphatidylinositol signaling system
    107276719
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107276719
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    107276719
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107276719
   03036 Chromosome and associated proteins [BR:osa03036]
    107276719
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107276719
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107276719
Membrane trafficking [BR:osa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    107276719
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     107276719
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107276719
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EFhand_Ca_insen SurA_N_2 SurA_N_3
Other DBs
NCBI-GeneID: 107276719
NCBI-ProteinID: XP_015616721
UniProt: B9G889
LinkDB
Position
11:complement(22173342..22175425)
AA seq 152 aa
MESHLNEQQISDFRDAFSLFDKNNDGCISREELATVLTRLGMAPSQEDLQDMIVAVDEDG
NGTIEFDEFLAIMKKKLYENDKGDDEEELRKAFRIFDKDDNGFISRNELSMVMASLGEEM
TEDEIDDMMKAADSNNDGQVDYEEFKRVMMST
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagagccatctcaacgagcagcagatctccgatttccgagacgccttctcgctgttc
gacaagaacaatgacggttgcataagtagggaggagctggccaccgtgctcacacgcctg
ggcatggcgccaagccaggaggatctgcaagacatgatcgtggccgtcgatgaggatggc
aatggcacgatcgagttcgacgagttcctcgcaataatgaagaagaaactatatgagaat
gacaagggtgatgatgaggaagaactgaggaaggctttcaggattttcgacaaggatgat
aatggattcatatcacgcaatgagttaagcatggtgatggctagtcttggagaggagatg
acagaagatgagattgatgatatgatgaaggcagctgatagcaacaacgacgggcaagtt
gattacgaagagttcaagcgagtcatgatgagcacgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277351
Entry
107277351         CDS       T01015                                 
Name
(RefSeq) putative calcium-binding protein CML19
  KO
K13448  calcium-binding protein CML
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107277351
SSDB
Motif
Pfam: EF-hand_8 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_4 EF-hand_9 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 107277351
NCBI-ProteinID: XP_015645979
UniProt: Q8RYJ8
LinkDB
Position
1:42080001..42080689
AA seq 146 aa
MVAATAEFRRVFSAFDRDADGKISAAELRLCMKAALGEDMSAEEAEALVSSADTDDDGLL
DEEEFTKLAVQLEMGDEEERCRGLMEAFRMYEMEGEGRITPASLKRMLSKLGSHQGIEEC
QTMICRFDLDGDGVISFEEFKIMMDA
NT seq 441 nt   +upstreamnt  +downstreamnt
atggtggccgcgacagccgagttcaggcgagtgttctccgcgttcgaccgcgacgccgac
ggcaagatctcggcggcggagctgcggctctgcatgaaggccgcgctcggcgaggacatg
tccgccgaggaggccgaggcgctcgtctcgtcggcggacaccgacgacgacgggctgctc
gacgaggaggagttcacgaagctggcggtgcagcttgagatgggagacgaggaggagagg
tgcaggggactaatggaggcgttccggatgtacgagatggaaggggaggggcgcatcact
ccggcgagcttgaaacggatgctgagcaagctcggatcgcatcagggcatcgaggagtgc
caaacaatgatctgcaggtttgacctcgatggagatggagtcatcagctttgaggagttc
aagatcatgatggatgcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277511
Entry
107277511         CDS       T01015                                 
Name
(RefSeq) putative calcium-binding protein CML23
  KO
K13448  calcium-binding protein CML
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107277511
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 Dockerin_1 SPARC_Ca_bdg Tsc35
Other DBs
NCBI-GeneID: 107277511
NCBI-ProteinID: XP_015646228
UniProt: Q8RYJ9
LinkDB
Position
1:complement(42078416..42079364)
AA seq 151 aa
MVASDEFRRVFGSFDQDGDGKISATELRLCVKASLGEDMPDEEVQALMALADTDGDGLLD
EEEFVRLVTEMEADGDEEEDDDDETCRCLREAFAMYEMEGRGCITPLSLKLMLSKLGTHL
DVAECQAMICRFDMNGDGVLTFDEFKTMMMA
NT seq 456 nt   +upstreamnt  +downstreamnt
atggttgcctccgacgagttcaggcgcgtctttggatcgttcgaccaggacggcgacggc
aagatctccgccaccgagctgcggctctgcgtgaaggcgtccctcggcgaggacatgccg
gacgaggaggtgcaggcgctcatggcgttggcggacaccgacggcgacgggttgctggac
gaagaggagttcgtgaggctggtgacagaaatggaggcggatggtgatgaggaagaagac
gacgacgacgagacgtgcaggtgcctaagggaggcgtttgcgatgtacgagatggaaggg
agaggatgcatcacgccgctgagcctgaagctgatgctgagcaagctgggcacgcacctg
gacgttgcagagtgccaggccatgatctgcaggttcgacatgaacggagacggggtgctc
accttcgacgagttcaagactatgatgatggcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324037
Entry
4324037           CDS       T01015                                 
Name
(RefSeq) probable calcium-binding protein CML11
  KO
K13448  calcium-binding protein CML
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4324037
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 SPARC_Ca_bdg EF-hand_9 EF-hand_4 SUIM_assoc
Other DBs
NCBI-GeneID: 4324037
NCBI-ProteinID: XP_015634896
UniProt: Q9AWK2
LinkDB
Position
1:17581101..17582139
AA seq 211 aa
MSEPATTTPTPTPAGDHDAAATACKPAETTTALITCRSSSCSAQQQQQQQQQQEEPLGDD
QLGELREIFRSFDRNGDGSLTQLELGSLLRSLGLKPSTDELDSLIQRADTNSNGLIEFSE
FVALVAPELLYDRAPYSEDQIRRLFNIFDRDGNGFITAAELAHSMAKLGHALTVKELTGM
IKEADTDGDGRISFQEFSRAITAAAFDNIFS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgagcgagccggccaccaccacccccacccccacccccgccggagaccacgacgcagcc
gccaccgcatgcaagcctgcggagacgaccacggccctgatcacctgcaggagcagcagc
tgcagcgcccagcagcagcagcagcagcagcagcagcaggaggagccgctcggcgacgac
cagctgggtgagctgcgggagatcttccgctccttcgaccgcaacggcgacggcagcctg
acgcagctggagctcgggtccctcctccgctccctcggcctcaagcccagcaccgacgag
ctggactccctcatccagcgcgccgacaccaactccaacggcctcatcgagttctccgag
ttcgtcgccctcgtcgcgcccgagctcctctacgaccgcgccccctactccgaggaccag
atccgccgcctcttcaacatcttcgaccgcgacggcaacggcttcatcaccgccgccgag
ctcgcccactccatggccaagctcggccacgcgctcaccgtcaaggagctcaccggcatg
atcaaggaagccgacaccgacggcgacggccgcatcagcttccaggaattctcccgcgcc
atcaccgccgccgcatttgacaacatcttctcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324100
Entry
4324100           CDS       T01015                                 
Name
(RefSeq) probable calcium-binding protein CML12
  KO
K13448  calcium-binding protein CML
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4324100
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_9 SPARC_Ca_bdg EF-hand_4 DNA_pol3_alpha
Other DBs
NCBI-GeneID: 4324100
NCBI-ProteinID: XP_015621457
UniProt: Q5ZD81
LinkDB
Position
1:complement(23810476..23811678)
AA seq 249 aa
MQSQRERPREDRVHEETRGADHAHPSVPHAAAAASATATETATRTMSLHAGGVVVVDGKE
KGKKEEGEGKRKGKAPATAEAVRGRARLRGEQLRQLHEIFLRFDLDGDGSLTKLELAALL
RSLGLRPAAGDEIHALIAAIDADGNGTVEFDELASSLADLILGPCRPSVAVDQAELAEAF
RAFDRDGNGFISAAELARSMARMGHPICYAELTDMMREADTDGDGLISFEEFTAIMAKSA
LDFLGLAAL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcagagccagagggagaggccccgcgaagaccgcgtccacgaagaaacccgaggcgca
gaccacgcccatccatccgttccgcacgcggcggcggcggcgtcggcgacggcgacggag
acggcgacgcgaaccatgtccctccacgccggcggcgtcgtcgtcgtcgacgggaaggag
aaggggaagaaggaggagggggaggggaagcggaaggggaaggccccagctacggcggag
gcggtccgcgggcgcgcgcggctgcgcggggagcagctgcgccagctgcacgagatcttc
ctccggttcgacctcgacggcgacgggagcctcaccaagctggagctcgccgcgctcctc
cgctctctcggcctccgcccggccgcgggggacgagatccacgccctcatcgccgccatc
gacgccgacggcaacggcaccgtcgagttcgacgagctcgcctcctccctcgccgacctc
atcctcggcccgtgccgcccctccgtcgccgtcgaccaggcggagctcgccgaggccttc
agggccttcgaccgcgacggcaacggcttcatctccgccgccgagctcgcgcgctccatg
gcgcggatgggccaccccatctgctacgccgaactcaccgacatgatgcgcgaggccgac
accgacggcgacggcctcatcagcttcgaggagttcaccgccatcatggccaagtccgcc
ctcgatttcctcggcctcgccgccttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324384
Entry
4324384           CDS       T01015                                 
Name
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04070  Phosphatidylinositol signaling system
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4324384
   04070 Phosphatidylinositol signaling system
    4324384
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4324384
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4324384
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324384
   03036 Chromosome and associated proteins [BR:osa03036]
    4324384
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4324384
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     4324384
Membrane trafficking [BR:osa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    4324384
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     4324384
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4324384
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen Dockerin_1 Caleosin RNA_pol_Rpb4 DUF5580 MotA_activ DUF6279 Poly_export SurA_N_2 SurA_N_3 Fe_hyd_lg_C MecA_N RTX_C
Other DBs
NCBI-GeneID: 4324384
NCBI-ProteinID: XP_015622341
UniProt: Q0JNS6
LinkDB
Position
1:complement(9195526..9198964)
AA seq 149 aa
MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADVDGDGQINYEEFVKVMMAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcggaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc
gacaaggacggcgacggctgcatcaccaccaaggagcttggaactgtgatgcgctcatta
gggcagaaccccactgaggctgagcttcaggacatgatcaacgaggtggatgctgatgga
aatggaacgattgactttcctgagtttctcaacctgatggcacgcaagatgaaggacact
gattctgaggaggagctcaaggaagccttccgtgtatttgacaaggaccagaatggcttc
atctcggcagctgaactccgtcatgtcatgaccaaccttggtgagaagcttacagacgag
gaggtggacgagatgatccgtgaggctgatgtcgatggtgatggtcagatcaattacgaa
gaattcgtgaaggtgatgatggccaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325408
Entry
4325408           CDS       T01015                                 
Name
(RefSeq) probable calcium-binding protein CML31
  KO
K13448  calcium-binding protein CML
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4325408
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5
Other DBs
NCBI-GeneID: 4325408
NCBI-ProteinID: XP_015631059
UniProt: Q8RYK0 B7E7Q9
LinkDB
Position
1:complement(42074130..42074982)
AA seq 151 aa
MVVASAASPCESSALFATFDHDGDGRISAAELRLCMKTTLGEEVSDEEAGQLVASVDADG
DGLLCEAEFVRLVQAAEVEEEDERRGTGLREAFGMYEMEGEGCITPTSLRRMLRRLGSDQ
DIDDCRAMICRFDLNGDGVLSFDEFKIMMNA
NT seq 456 nt   +upstreamnt  +downstreamnt
atggttgttgcatcagcagcatcgccgtgcgagtccagtgcgttgttcgcgacgttcgac
cacgacggcgacggcaggatctccgcggcggagctgcggctgtgcatgaagacgacgctc
ggggaggaggtgtcggacgaggaggcggggcagctggtggcgtcggtggacgcggacggc
gacgggctgctgtgcgaggcggagttcgtgcggctggtgcaggcggcggaggtggaggag
gaagacgagcggcggggcaccggcctccgggaggcgttcggcatgtacgagatggaaggg
gaagggtgcatcacgccgacgagcctcaggcggatgctgcgccggctgggctccgaccag
gacatcgacgactgccgcgccatgatctgcaggttcgatctcaacggcgacggcgtcctc
agcttcgacgagttcaagatcatgatgaacgcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325488
Entry
4325488           CDS       T01015                                 
Name
(RefSeq) probable calcium-binding protein CML41
  KO
K13448  calcium-binding protein CML
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4325488
SSDB
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_7 EF-hand_5
Other DBs
NCBI-GeneID: 4325488
NCBI-ProteinID: XP_015633272
UniProt: Q94DW4 A0A0P0V8L2
LinkDB
Position
1:complement(32258882..32260038)
AA seq 220 aa
MAGVEVSKPSRRLSPKGSFKLSLPSLLACGQCKATAVSPPESPTGVGARSFSSSASSSAG
TSRGRERDRLAELREIFGHFDRDMDGRISGDELREFFASMGDDSGAAAAAAAAMGLDGAA
GGGESGGGGGGLMLAFEDFVRIVERKGGEEEEREDLRRAFGAFEAVKGSGRITPRGLQRV
LSQLGDEASVAECEAMISAYDDDGDGELDFHDFHRMMSQD
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgggcgtcgaggtctccaagccgtcgaggcgcctgtcgccgaaggggagcttcaag
ctgagcctgcccagcctgctggcgtgcgggcagtgcaaggccacggccgtctcgccgccg
gagtcccccacgggcgtcggcgcgaggtcgttctcctcgtcggcgtcgtcgtcggcgggg
acgtcccgggggagggagcgcgaccgcctggcggagctccgggagatcttcggccacttc
gaccgcgacatggacgggcggatctccggcgacgagctccgcgagttcttcgcgtccatg
ggcgacgactccggcgccgccgccgccgccgccgcggcgatggggctcgacggcgcggcg
ggcggcggcgagagcggcggcggcggtggcgggctgatgctggcgttcgaggacttcgtg
cggatcgtggagcggaagggcggggaggaggaggagcgggaggacctgcggcgcgcgttc
ggggcgttcgaggcggtgaaggggtccgggaggatcacgccgcgcgggctgcagcgcgtg
ctcagccagctcggcgacgaggcgtccgtcgccgagtgcgaggccatgataagcgcctac
gacgacgacggcgacggcgagctcgacttccacgacttccaccgcatgatgagccaagac
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325693
Entry
4325693           CDS       T01015                                 
Name
(RefSeq) probable calcium-binding protein CML16
  KO
K13448  calcium-binding protein CML
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4325693
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Dockerin_1 EF-hand_9 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 4325693
NCBI-ProteinID: XP_015620971
UniProt: Q5ZCK5
LinkDB
Position
1:complement(1931013..1931976)
AA seq 181 aa
MSNTTEKKMPQQQQVERPTALAPADAEIERVFTRFDADGDGRISPSELAAVTRAIAPPPS
ESAGGREVAAMMNELDTDRDGFVDLGEFAAFHGRGRGDAEHEAELRAAFDVYDVDGDGRI
TAAELGKVLGRIGEGCSAEECERMIASVDVDGDGCVGFEEFKKMMCRDAAATGGADKAKT
E
NT seq 546 nt   +upstreamnt  +downstreamnt
atgtcgaacaccaccgagaagaagatgccgcagcagcagcaggttgagaggccgacggcg
ttggcgccggcggacgcggagatcgagagggtcttcacccgcttcgacgcggacggggac
ggcaggatctccccctcggagctggccgcggtgacgcgcgccatcgcgccgccgcccagc
gagtccgccggcggccgcgaggtggccgccatgatgaacgagctcgacaccgaccgcgac
ggcttcgtcgacctcggcgagttcgcggcgttccacggccgcgggcgcggggacgccgag
cacgaggccgagctgcgcgccgcgttcgacgtgtacgacgtcgacggcgacggccgcatc
acggcggccgagctcggcaaggtcctcggccggatcggcgagggctgcagcgccgaggag
tgcgagaggatgatcgcctccgtcgacgtcgacggcgatggctgcgtcgggttcgaggag
ttcaagaagatgatgtgccgtgatgccgctgcaaccggcggcgctgacaaggccaagacg
gagtaa

DBGET integrated database retrieval system