KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276486
Entry
107276486         CDS       T01015                                 
Name
(RefSeq) dolichol phosphate-mannose biosynthesis regulatory protein-like
  KO
K09658  dolichol phosphate-mannose biosynthesis regulatory protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107276486
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    107276486
SSDB
Motif
Pfam: DPM2 PIG-P DUF485 DHHC
Other DBs
NCBI-GeneID: 107276486
NCBI-ProteinID: XP_015616715
UniProt: A0A0P0Y1I9
LinkDB
Position
11:complement(11990063..11990587)
AA seq 82 aa
MELGDKAVGFILTLTSLSIFTYYTFWVIILPFVDSDHFAHKYFLPQEYAILIPVLVGVIV
LSFLSVFVGLVMLKSKKKKKTT
NT seq 249 nt   +upstreamnt  +downstreamnt
atggaattgggggacaaggcagtaggctttattttaaccttgacaagtctatccatcttt
acatactatactttctgggtcatcatcctgccatttgttgacagtgatcacttcgcccac
aagtactttctgcctcaagagtatgctattttgatcccagtgcttgtcggcgtgattgtc
ctatctttcttaagcgtgttcgtgggtcttgttatgctcaagtcaaagaaaaagaagaag
accacttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269261
Entry
9269261           CDS       T01015                                 
Name
(RefSeq) dolichol phosphate-mannose biosynthesis regulatory protein
  KO
K09658  dolichol phosphate-mannose biosynthesis regulatory protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    9269261
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    9269261
SSDB
Motif
Pfam: DPM2 PIG-P
Other DBs
NCBI-GeneID: 9269261
NCBI-ProteinID: XP_015622839
UniProt: Q6Z2X5
LinkDB
Position
2:complement(2141633..2144575)
AA seq 82 aa
MELGDKAVGFILTLTSLSIFTYYTFWVIILPFVDSDHFVHKYFLPQEYAILIPVLAGVIL
LSFLSVFMGLVMLKSKKKKKTT
NT seq 249 nt   +upstreamnt  +downstreamnt
atggaattgggggacaaggcagtaggctttattttaaccttgacaagtctatccatcttt
acatactatactttctgggtcatcatcctgccatttgttgacagtgatcacttcgtccac
aagtactttctgcctcaagagtatgctattttgatcccagtgcttgctggcgtgattctc
ctatctttcttaagcgtgttcatgggtcttgttatgctcaagtcaaagaaaaagaagaag
accacttga

DBGET integrated database retrieval system