KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276500
Entry
107276500         CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIB-like
  KO
K03124  transcription initiation factor TFIIB
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    107276500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    107276500
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     107276500
 Prokaryotic type
  Archaeal type
    TFB
     107276500
SSDB
Motif
Pfam: TFIIB TF_Zn_Ribbon Cyclin_N XPB_DRD Ribosomal_S27e
Other DBs
NCBI-GeneID: 107276500
NCBI-ProteinID: XP_015629466
LinkDB
Position
3:4886185..4887399
AA seq 333 aa
MSKTESNPTPSSIRLRHWQKDKSATMCSVAGNEQCYCPECHRTTVVVVDHATGDTICTEC
ALVLEERYIDETSEWRTFSDAGSGEDRDPNRVGGCSDPFLSHAELGTVVAPAKRQAKDTA
SPPHVRVDSKSGQDSSLAVAFRAISDMADRLQLVATIRDRAKELFKKMEEAKLCARVRNR
DAAYAACLHIACRNEGNPRTLKELASVMRDCQDKKEIGRMERIIRRHLGEEAGTAMEMGV
VRAADYMSRFGSRLGMGKPEVREAQRAAQTLEDKLDVRRNPESIAAAIIYMVVQRAGAQT
SARDVSKASGVAEATIKEACKELSQHEELLFSS
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtccaagaccgagagtaatccgactccgagttcgatcaggctgcgtcattggcaaaag
gataaatccgcgacgatgtgtagcgtcgccggcaacgagcagtgttactgcccggagtgc
caccgcacgacggtggtggtggtggaccacgccaccggcgacaccatctgcaccgagtgc
gcgctcgtcctggaggagcggtacatcgacgagacctccgagtggcgcacgttctccgac
gccggcagcggcgaggaccgcgaccccaaccgcgtcggcggctgctccgaccccttcctc
tcgcacgcggagctcggcaccgtcgtcgcgccggccaagcggcaagcgaaggacaccgcc
tccccgcctcatgtgcgcgtcgactccaagtcgggccaagacagctcgctggccgtcgcg
ttccgcgccatctccgacatggcggaccgcctccagctcgtggccaccatcagagaccgg
gccaaggagctgttcaagaagatggaggaggcgaagctgtgcgccagggtgcggaaccgc
gacgccgcgtacgcggcctgcctccacatcgcgtgccgcaacgagggcaacccgcggacg
ctgaaggagctcgcctcggtgatgcgcgattgccaggacaagaaggagatcgggaggatg
gagaggatcatcaggaggcacctcggggaggaggccgggacggccatggagatgggcgtc
gtgcgcgccgccgactacatgagccgcttcggctcgcggctcgggatgggcaagccggag
gtgcgggaggcgcagagggcggcgcagacgctggaggacaagctcgacgtgcggcgcaac
ccggagtccatcgccgctgcgatcatctacatggtggtgcagcgcgccggcgcccagacg
tccgcgcgcgacgtgtccaaggcctccggcgtcgccgaggcaaccatcaaggaggcctgc
aaggagctgagccagcatgaagagctgctcttctcctcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277507
Entry
107277507         CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIB-like
  KO
K03124  transcription initiation factor TFIIB
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    107277507
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    107277507
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     107277507
 Prokaryotic type
  Archaeal type
    TFB
     107277507
SSDB
Motif
Pfam: TFIIB TF_Zn_Ribbon HTH_Tnp_ISL3 HTH_23
Other DBs
NCBI-GeneID: 107277507
NCBI-ProteinID: XP_015646322
UniProt: Q6Z470
LinkDB
Position
7:19068229..19069538
AA seq 354 aa
MYGSPDGVRYCQQCERTTSMVLDHDTGDAICTECAIVLGNGNDPRRPAVASAATKHGGAD
APADDDPLLQGSDVVAAAAAEVACSVAPTKLQAEGAAPAAPPRMRGAVVAPKVRGGGGGA
VTKARGGVPDTNKSLAEGFDAIDNMASRLGLAGNVRDRGKDVLRKVEEAKVCARGRSRDA
LYAACLHTACRMEGAPRTLKELIAATPDAAATKRNLGKFIHAIKRLLGSNDEEAEAGQDQ
AGSKATNGCGGGGGAGAVVRASNYLLRYGSAVGMSGQEVSAAQRAASRLDESLDVRRNPQ
SIAAAIIYMAVQRAGGGGGRSKSVREVSAATGVSESTIKDAYKDLCQHAEVLFG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtacggctcccccgacggcgtccgctactgccagcagtgcgagcgcaccacgtccatg
gtgctcgaccacgacaccggcgacgccatctgcaccgagtgcgccatcgtgctcggcaac
ggcaacgacccgcgccgccccgccgtcgcctctgcggccaccaaacacggcggtgccgac
gctcctgccgatgatgatccgttgctccagggcagcgacgtggtcgccgccgccgccgcg
gaggtggcatgctccgttgccccgaccaagctgcaggctgagggcgctgcgccggcggcg
ccgccgaggatgcggggcgctgtcgtggcgccgaaggtgcgaggcggcggtggcggcgcc
gtgacgaaggcccggggcggcgtccccgacacgaacaagtcgctcgccgaggggttcgac
gccatcgacaacatggcgtcccggctcgggctcgcgggcaacgtgcgcgaccgcgggaag
gacgtgctgaggaaggtggaggaggccaaggtttgcgccagggggcggagccgggacgcg
ctctacgcggcgtgcctccacaccgcgtgccgcatggagggcgcgccgcggacgctcaag
gagctcatcgccgcgacgcccgacgcggcggcgacgaagaggaacctgggcaagttcatc
cacgcgatcaagaggctcctcgggagcaacgatgaggaggccgaggccgggcaggatcaa
gcgggcagcaaggcgacgaacggctgcggcggtggcggcggcgccggcgcggtggtgcgc
gccagcaactacctgctccgctacgggtcggcggtcgggatgagcggccaggaggtgagc
gcggcgcagcgcgcggcgagcaggctggacgagagcctcgacgtgcggcgaaacccgcag
tccatcgcggccgccatcatctacatggccgtgcagcgcgccggcggcggcggcggcagg
agcaagagcgtccgcgaggtgtccgccgccacgggcgtcagcgaatcgaccatcaaggac
gcgtacaaggacctgtgccagcacgccgaggtgctcttcggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331943
Entry
4331943           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4331943
  KO
K03124  transcription initiation factor TFIIB
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4331943
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4331943
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     4331943
 Prokaryotic type
  Archaeal type
    TFB
     4331943
SSDB
Motif
Pfam: TFIIB Cyclin_C HTH_Mga HTH_23
Other DBs
NCBI-GeneID: 4331943
NCBI-ProteinID: XP_015631058
LinkDB
Position
3:complement(5082290..5085075)
AA seq 530 aa
MSQPTQCPYCRASGPARCVTTQPPLSRAVSECSSCARLVLERHLHTHPFFPLLPSLHPLP
LVTPDLADAAPSPSPSAASASGDDDDDDDPFLPAGFVSAFSAFSLERHPVLARSASAFSG
QLAELERALAVESAASSTPDPAGPMVSVDSLRAYVQIVDVASILRLDRDIADHAFELFKD
CSSATCLRNRSVEALATAALVQAIREAQEPRTLQEISTASNLPQKEIGKYIKILGESLKL
SQPLNSNSIAVHMPRFCSLLQLNKSAQELAAHIGEVVVNKCFCTRRNPISISAAAIYLAC
QLEDKRKTQAEICKVTGLTEVTLRKVYKELLENWDDLLPPNYTPATPPEKAFPMTTIYSS
RSSSGKDLYQDKQLDSAKLKSSEAAEPDHMVIVKEEEDKKIGPFSRPSAKTETHDLNQAI
WTPNVSSTPFSSSPKLDHDKTETSVRGINLNEASCTMDTDRPDMPVKSPFAERWLNESKV
IPSPSRQPAPWQLKQGAPSAGSSYHSMPYGLDLLSRGKRNTGDGGDKEGR
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtcgcagccgacgcagtgcccctactgccgcgcctccggcccggcgcgctgcgtcacg
acgcagccgccgctctcccgcgccgtctccgagtgctcctcctgcgcccgcctcgtcctc
gagcgccacctccacacccaccccttcttccccctcctcccctcgctccacccgctcccc
ctcgtcacccccgacctcgccgacgccgcgccgtcgccgtccccctcggccgcctccgcc
tccggcgacgacgacgacgacgacgaccccttcctcccggccggcttcgtctccgccttc
tcggccttctccctcgagcgccaccccgtcctcgcccgctccgcgtccgccttctccggc
caactcgccgagctcgagcgcgcgctcgccgtcgaatccgcggcctcctccactccggac
cccgcggggcctatggtctccgtcgacagcctccgcgcctacgtccagatcgtggacgtc
gcctccatcctgaggctggaccgggacatagccgaccacgccttcgagctcttcaaggac
tgctcctccgctacgtgcctcaggaaccgcagcgtcgaggcgcttgccacggccgcactc
gtgcaggccatccgcgaggcgcaggagcccaggaccttgcaggaaatctctactgctagc
aatcttccccagaaagaaattggaaaatacatcaaaatacttggtgaatcactgaaactg
agccaacctcttaacagcaactcaatagcagttcatatgcctcggttttgcagcctactc
cagctcaataaatctgctcaggaacttgcagcccatattggtgaggttgttgttaataaa
tgcttctgcacacggaggaatcccataagcatatcagctgcagctatctatcttgcgtgt
cagcttgaagacaagcggaaaactcaggcagagatctgtaaggtaacaggccttacagag
gttactctgcgtaaagtgtataaagaactgttggagaattgggatgatttgctaccccct
aactatacaccagctacaccaccagagaaagctttcccaatgaccaccatttattcatcg
cgctcatcgtctggtaaagatctttatcaagataagcagttagacagtgctaagctaaag
agctcagaagctgcagagcctgatcacatggtcattgtaaaagaggaggaagacaagaaa
attggtccatttagtcgaccgagtgcaaaaaccgagacccatgacttgaatcaagcaatt
tggacgccaaatgtctcttcaacaccattctcttcatcaccgaaattggatcatgacaag
acggaaacaagcgtccgtgggataaaccttaacgaggcatcctgcacaatggatactgac
agaccagacatgcctgtgaagtcaccctttgctgagaggtggctaaatgaatcaaaggtg
atcccttctcccagtaggcagcctgcaccatggcagcttaagcaaggagcaccatcagct
gggtcctcgtatcatagtatgccgtacggcctggaccttctgtcacgtggaaaaagaaat
actggagatggtggtgataaggaggggaggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339510
Entry
4339510           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIB-like
  KO
K03124  transcription initiation factor TFIIB
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4339510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4339510
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     4339510
 Prokaryotic type
  Archaeal type
    TFB
     4339510
SSDB
Motif
Pfam: TFIIB TF_Zn_Ribbon Cyclin_N HTH_Tnp_ISL3 Ribosomal_S27e
Other DBs
NCBI-GeneID: 4339510
NCBI-ProteinID: XP_015640766
UniProt: Q5KQD1 Q0DG84
LinkDB
Position
5:complement(27201367..27202875)
AA seq 316 aa
MHDAAANDGAYCPDCRRATAVVLDHTTGDTICTECALVLDARYIDETSEWRTFANDGASD
DRDPNRVGDRADPFLPDHVGGTTIAYSSAPPKSADAAPLLTRRRVDVVGPSPENALVAAF
RGIADMADRLGLVATIRDRAKEVFKKLGEAPTKGLPRGRNRDAVYAACLFIACRNEGMPR
TYKELASVTAEGAAAKKEIGRLTTLIKKHLGDQGEGRAMDIGVVRSTDYLRRFCSRLGLG
HQDVRAAGDAVRRLEERLDVRRNPESIAAAIIYMVVQRAGGSKSVRDVSTATGVAEGTIT
AAHKELAPHASVLFGG
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcacgacgcggcggcgaacgacggggcctactgcccggactgccggcgcgcgacggcg
gtggtgctcgaccacaccaccggcgacaccatctgcaccgagtgcgcgctcgtcctcgac
gcgcgctacatcgacgagacgtccgagtggcgcaccttcgccaacgacggcgccagcgac
gaccgcgaccccaaccgcgtcggcgaccgcgccgaccccttcctccccgaccacgtcggc
ggcaccaccatcgcctactcctccgccccgcccaagtccgccgacgccgccccgctgctg
acgaggaggagggtcgacgtcgtcggcccgtccccggagaacgcgctcgtcgccgcgttc
aggggcatcgccgacatggccgaccgcctcggcctcgtcgccaccatccgcgaccgcgcc
aaggaggtgttcaagaagctcggcgaggcgcccaccaaggggttaccgcgcggccggaac
cgcgacgccgtctacgccgcctgcctcttcatcgcgtgccgcaacgaggggatgccgcgg
acgtacaaggagctcgcctccgtcaccgccgagggcgccgccgccaagaaggagatcggc
aggctcaccaccctcatcaagaagcacctcggcgaccagggcgaggggcgggcgatggac
atcggcgtcgtgcgctccaccgactacctccgccgcttctgctccaggctcggcctgggc
caccaggacgtgcgcgccgccggggacgcggtgcgccgcctcgaggagcgcctcgacgtg
cgccgcaacccggagtccatcgccgccgccatcatctacatggtcgtgcagcgcgccggc
ggcagcaagtccgtgcgcgacgtctccacggccaccggcgtcgccgagggcaccatcacg
gcggcgcacaaggagctggctccccacgccagcgtcctcttcggtggctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347689
Entry
4347689           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIB
  KO
K03124  transcription initiation factor TFIIB
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4347689
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4347689
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     4347689
 Prokaryotic type
  Archaeal type
    TFB
     4347689
SSDB
Motif
Pfam: TFIIB TF_Zn_Ribbon Cyclin_N Ribosomal_S27e zf-ribbon_3 RB_B
Other DBs
NCBI-GeneID: 4347689
NCBI-ProteinID: XP_015651154
UniProt: Q8W0W3 G8CTL4
LinkDB
Position
9:21028996..21032009
AA seq 312 aa
MSDSFCPDCKKHTEVAFDHSAGDTVCTECGLVLEAHSVDETSEWRTFANESSDNDPVRVG
GPTNPLLTDGGLSTVIAKPNGAQGEFLSSSLGRWQNRGSNPDRSLILAFRTIANMADRLG
LVATIKDRANEIYKKVEDLKSIRGRNQDAILAACLYIACRQEDRPRTVKEICSVANGATK
KEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDFLRRFCSTLGMNNQAVKAAQEAVQRSEEL
DIRRSPISIAAAVIYMITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPYASRLIPNTY
AKEEDLKNLCTP
NT seq 939 nt   +upstreamnt  +downstreamnt
atgagcgactcgttctgcccggactgcaagaagcacacggaggtggcgttcgaccactcg
gcgggggacacagtgtgcacggagtgcggcctcgtcctggaggcgcactccgtcgacgag
acctccgagtggcggacgttcgccaacgagtccagcgacaacgaccccgtccgtgtcggc
ggcccgaccaacccgctcctcaccgacggcggcctctccaccgtcatcgccaagcccaac
ggcgcccagggggagttcctctcctcctccctcggcaggtggcagaaccgcggctccaac
cccgaccgctccctcatcctcgccttccgcaccatcgccaacatggccgacaggttaggt
cttgtggctacaatcaaggaccgagccaatgaaatatataagaaggtggaagatctcaag
tctatcaggggaagaaatcaagatgccatattagctgcctgtttgtatattgcttgtaga
caagaggatcggcctagaactgtaaaagaaatatgttcggtcgctaatggagcaacaaag
aaagagataggccgagcaaaggaatttatcgtgaagcaactggaagttgaaatgggtcaa
tctatggagatgggaaccatccatgctggagatttcctgaggcgtttctgttcaactctt
gggatgaacaatcaagctgttaaagcagcccaggaagcagttcagcgttcagaggaactt
gatataaggaggagtcctatttccattgcggctgctgtcatttacatgataacccaactc
tcagatgataagaagcctctgaaagacatatccttggctactggtgtggcagaaggtacc
atcagaaattcatacaaggatctgtatccctatgcttcaaggctcatcccaaacacctat
gccaaggaggaagacctgaagaatctgtgcacaccatag

DBGET integrated database retrieval system