KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276510
Entry
107276510         CDS       T01015                                 
Name
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At3g47570
  KO
K13437  receptor kinase-like protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107276510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    107276510
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   107276510
SSDB
Motif
Pfam: LRR_8 Pkinase PK_Tyr_Ser-Thr LRR_4 LRR_1 LRRNT_2 LRR_6 ABC1 APH
Other DBs
NCBI-GeneID: 107276510
NCBI-ProteinID: XP_015616297
UniProt: Q2R2D5
LinkDB
Position
11:complement(21273409..21277458)
AA seq 1037 aa
MARSPTSVMISSLLLLLLIGPASSDDAAAAAAARTSTGGVAGDELALLSFKSSLLHQGGL
SLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELD
LSDNYLSGEIPPELSRLSRLQLLELSGNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPR
EIGASLKHLSNLYLHTNGLSGEIPSALGNLTSLQYFDLSCNRLSGAIPSSLGQLSSSLLT
MNLRQNNLSGMIPNSIWNLSSLRAFSVSENKLGGMIPTNAFKTLHLLEVIDMGTNRFYGK
IPASVANASHLTQLQIDGNLFSGIITSGFGRLRNLTTLYLWRNLFQTREQEDWGFISDLT
NCSKLQTLDLGENNLGGVLPNSFSNLSTSLSFLALDLNKITGSIPKDIGNLIGLQHLYLC
NNNFRGSLPSSLGRLRNLGILVAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTL
SNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHA
ESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTS
LADITMLHSLNLSFNSFMGEVPTIGAFADASGISIQGNAKLCGGIPDLHLPRCCPLLENR
KHFPVLPISVSLVAALAILSSLYLLITWHKRTKKGAPSRTSMKGHPLVSYSQLVKATDGF
APTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIV
TICSSIDNRGNDFKAIVYDFMPSGSLEDWIHPETNDPADQRHLNLHRRVTILLDVACALD
YLHRHGPEPVVHCDVKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFRGTIG
YAAPEYGVGHIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDV
VDTKLILDSENWLNSTNNSPCRRITECIVSLLRLGLSCSQVLPLSRTPTGDIIDELNAIK
QNLSGLFPVCEGASLEF
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggcgagatcaccaacgtcggtcatgatctcttctttgctgctgctgctgttgatcggc
ccagcgagcagtgacgatgctgctgctgctgctgctgctcgtaccagtacaggcggcgtc
gccggcgacgaactcgcgctgctctctttcaagtcatccctgctacaccaggggggcttg
tcgctggcatcttggaacacgtccggccacggccagcactgcacatgggtgggtgttgtg
tgcggccgccgccgccgccggcacccacacagggtggtgaagctgctgctgcgctcgtcc
aacctgtccgggatcatctcgccgtcgctgggcaacctgtccttcctcagggagctggac
ctcagcgacaactacctctccggcgagataccaccggagctcagccgtctcagcaggctt
cagctgctggagctgagcggtaactccatccaagggagcatccccgcggccattggagca
tgcaccaagttgacatcgctagacctcagccacaaccaactgcgaggtatgatcccacgt
gagattggtgccagcttgaaacatctctcgaatttgtaccttcacaccaatggtttatca
ggagagattccatctgctttgggcaatctcactagccttcagtattttgatttgagctgc
aacagattatcaggagctataccttcatcgctagggcagctcagcagcagtctattgact
atgaatttgcgacagaacaatctaagtgggatgatccccaattctatctggaacctttcg
tctctaagagcgtttagtgtcagcgaaaacaagctaggtggtatgatccctacaaatgca
ttcaaaacccttcacctcctcgaggtgatagatatgggcactaaccgtttctatggcaaa
atccctgcctcagttgctaatgcttctcatctgacacagcttcagattgatggcaacttg
ttcagtggaattatcacctcggggtttggaaggttaagaaatctcacaacactgtatctc
tggagaaatttgtttcaaactagagaacaagaagattgggggttcatttctgacctaaca
aattgctccaaattacaaacattggacttgggagaaaataacctggggggagttcttcct
aattcgttttccaatctttccacttcgcttagttttcttgcacttgatttgaataagatc
acaggaagcattccaaaggatattggcaatcttattggcttacaacatctctatctctgc
aacaacaatttcagagggtctcttccatcatcgttgggcaggcttagaaacttaggcatt
ctagtcgcctacgaaaacaacttgagcggttcgatcccattggccataggaaatcttact
gaacttaatatcttactgctcggcaccaacaaattcagtggttggataccatacacactc
tcaaacctcacaaacttgttgtcattaggcctttcaactaataaccttagtggtccaata
cccagtgaattattcaatattcaaacactatcaataatgatcaatgtatcaaaaaataac
ttggagggatcaataccacaagaaatagggcatctcaaaaatctagtagaatttcatgca
gaatcgaatagattatcaggtaaaatccctaacacgcttggtgattgccagctcttacgg
tatctttatctgcaaaataatttgttatctggtagcatcccatcagccttgggtcagctg
aaaggtctcgaaactcttgatctctcaagcaacaatttgtcaggccagatacccacatcc
ttagcagatattactatgcttcattccttgaacctttctttcaacagctttatgggggaa
gtgccaaccattggtgctttcgcagatgcatccgggatctcaatccaaggcaatgccaaa
ctctgtggtggaatacctgatctacatctgcctcgatgttgtccattactagagaataga
aaacatttcccagttctacctatttctgtttctctggtcgcagcactggccatcctctca
tcactctacttgcttataacctggcacaagagaactaaaaagggagccccttcaagaact
tccatgaaaggccacccattggtctcttattcgcagttggtaaaagcaacagatggtttc
gcgccgactaatttgttgggttctggatcatttggctcagtatacaaaggaaagcttaat
atccaagatcatgttgcagtgaaggtactaaagcttgaaaatcctaaggcactcaagagt
ttcactgccgaatgtgaagcactacgaaatatgcgacatcgaaatcttgtcaagatagtt
acaatttgctcgagcattgataacagagggaacgatttcaaagcaattgtgtatgacttc
atgcccagcggcagtctggaagattggatacaccctgaaacaaatgatccagcagaccag
aggcacttgaatctgcatcgaagagtgaccatactacttgatgttgcctgtgcattggac
tatcttcaccgccatggccctgaacctgttgtacactgtgatgttaaatcaagcaatgtg
ctgttagattctgatatggtagcgcatgttggagattttgggcttgcaagaatacttgtt
gatgggacctcattgatacaacagtcaacaagctcgatgggatttagagggacaattggc
tatgcagcaccagagtatggcgtcgggcacattgcatcaacacatggagatatttacagc
tatggaattctagtgctggaaatagtaaccgggaagcggccaactgacagtacattcaga
cccgatttgggcctccgtcagtacgttgaactgggcctacatggcagagtgacggatgtt
gttgacacgaagctcattttggattctgagaactggctgaacagtacaaataattctcca
tgtagaagaatcactgaatgcattgtttcgctgcttagacttgggttgtcttgctctcag
gttttgccattgagtagaacgccaaccggagatatcatcgacgaactgaatgccatcaaa
cagaatctctccggattgtttccagtgtgtgaaggtgcgagcctcgaattctga

DBGET integrated database retrieval system