KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276513
Entry
107276513         CDS       T01015                                 
Name
(RefSeq) putative ubiquitin-conjugating enzyme E2 38
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107276513
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    107276513
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     107276513
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107276513
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 107276513
NCBI-ProteinID: XP_015613577
UniProt: A2ZWI0
LinkDB
Position
1:27857803..27862479
AA seq 430 aa
MPSPSPVPSSTAEGSSKNSPTKGSLSLGDLDAVEVLPASATAGWSSARQKRKWSQSGSTK
DVAGPSSIALKNVDPSDGVGAFPKAMSLADYLKLEGSDINLNINTYYYLVALGEGGIVVE
GQTSAEKPHQHKQMKHVDPKIDEKYVEFKQFDIVGDHSDHFYSNPRERKVQVVNEPGKDW
VKRIQHEWKVLEKDLPDNIFVRVYEDRLELLRAVIIGPSGTPYHDGLFFFDVYFPPQYPR
NPLLVIYHSGGMRLNPNLYACGKVCLSLLNTWPGDGCEKWNPSNSTLQVLVSIQALVLNA
KPYFNEPGFESYANTPRAEKKSIAYNQETFLLSCKTMLYSLRNPPKHFDDFIIGHFHKYG
HSILIGCNAYMDGAQVGSIIGGVKAIDKGNKGCSTKFKGSLKKLFEELMMEFIGIGVDCH
EFMIDTTLKL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgccatccccctcgcctgtaccctcttccacggcggagggttcttccaagaattccccc
accaaaggaagcttatcattgggggatcttgatgctgtcgaggtgttgccggcatcggcg
actgctggatggagttctgctcgccaaaaacgaaaatggagccagagtggttccactaag
gatgttgctggcccaagttctattgcattgaagaatgttgatccatcggatggagtagga
gctttccctaaagctatgtcacttgccgattacctcaagctggagggaagcgatatcaac
ttaaacataaatacatattattacttggttgcacttggtgagggaggtattgttgtagag
ggacaaacttctgctgagaagccgcaccagcataaacagatgaagcatgtggaccctaaa
attgatgaaaaatacgtggaatttaagcaatttgatattgtaggtgatcactctgatcac
ttctattcgaacccaagagaaaggaaggttcaagtagttaatgagcctgggaaggactgg
gtgaagcggattcaacatgaatggaaagtcctagagaaagatttgccagataatatattt
gtaagagtttatgaggataggttggagctgcttagagcagtcattattggaccatcaggc
actccttaccatgacgggctattcttttttgatgtttatttccctccccaatatcctaga
aaccctctgctagtgatctatcactctggaggtatgcggcttaatccaaatctctatgcc
tgtgggaaagtctgtctcagtttgttaaacacatggcctggtgatggatgtgagaagtgg
aacccatccaattcaacgctacaagtcctagtctccattcaagccttggtattaaatgca
aaaccttattttaatgaacctggtttcgaaagttatgctaatacacctcgggcagagaag
aagtctatagcttataatcaggagacttttctgttgtcctgcaaaacaatgttgtattct
cttcgcaatccaccaaagcattttgacgacttcattattggtcattttcacaaatatggg
catagtatcctcataggatgcaatgcctatatggatggtgcccaagttggaagcattata
ggaggggtgaaggctattgacaaaggcaacaaaggctgctcaacaaagtttaagggttca
ttgaagaaattatttgaggaacttatgatggaattcattggtataggtgttgattgtcat
gaattcatgatagacaccacattgaagctctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277097
Entry
107277097         CDS       T01015                                 
Name
(RefSeq) probable ubiquitin-conjugating enzyme E2 23
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107277097
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    107277097
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     107277097
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107277097
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 107277097
NCBI-ProteinID: XP_015638512
LinkDB
Position
5:3057657..3061959
AA seq 792 aa
MEVTSASDPAGQIGVVTAVSTAVDLVEHRADGDYGDAEAAPAARGLSPSGLRRVTEFSLG
DYVVCSGGGDQWLGRAVEVCVAVDVVFDDGAACRITGDRAQDRVIEVKVAANTYRRRGMN
GAFYPGQRVTGHHVLASPSIAFKDARWLRGYWKLTRLEGTVAKVAMTGVLVYWIASAQLG
TSKSLINASSPPAFQDPGDLTLFCSDDECPWAFGDRCFIATPPRHRRRRRQPRVPTDDDK
QEADLRATRWGARARAVDKVMLVSGTRTTADVLWQDGTLRRGVPSLELVPFDILNDHEFF
PGQHVVVDTMAAAEATTAAARRVGVVRRVDPKDQTVRVSWLDGGDGGGEETVASAYDLRK
YSRHDVFYGDVVVRLLPPPPESADAAGEGAAPPAQGTKAAAADLSWVGRVVDVRDGHVQV
RWGNGETSTAVHSEVRGVDMRSFWALEHEDAAAPAPDAAALPSSSDAGGGDGDGDGDGGD
SASDGGWKEKVEDDSLGVAHFDVVQCPPDHHFLDCKLEGAAHGNKWVKRVQKEWQILGND
NLPGTIYVRAFEDRMDLLRAAMVGAAGSPYHDGLFLFDLHLPATYPAAPPEVYYHSFGLR
VNPNLYPSGTVCLSLLNTFDGEGVEVWSPARSTLLQVLVSIQGLVLTADPYYNEAGYDAY
AGTPGGRRNAASYAENACLLTLRSALHLLRRPPRGFEGVVGAHFRRRGAHVLAACESYLR
GTRVAGDGGDGGGGERTCSAGFRLALRNVVPVLAAAFAEIGVEGCERFGDGELGQCSLTA
IDDSAASADASD
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggaggtcacgtcggcgtcggaccccgccggccagatcggcgtcgtcacggcggtgtcc
accgcggtcgacctcgtcgagcaccgcgccgacggcgactacggcgacgccgaggcggcg
cccgcggcgcgcgggctctcgccgtcggggctccgccgcgtcacggagttcagcctcggc
gactacgtcgtgtgttccggcggcggcgatcaatggctcggccgcgccgtggaggtgtgc
gtcgccgtcgacgtggtgttcgacgacggcgcggcgtgcaggatcaccggggaccgggcg
caggaccgcgtcatcgaggtcaaggtggcggcgaacacgtaccgccgccgcgggatgaac
ggcgcgttctacccaggccagcgcgtcaccggccaccacgtcctggcgtcgccgtcgatc
gccttcaaggacgcgcggtggctgagggggtactggaagctcacccgcctcgagggcacc
gtcgccaaggtcgccatgaccggcgtcctcgtctactggatcgcctcggcgcagctcggc
accagcaagagcctcatcaacgcgtcctcgccgccggcgttccaggaccccggcgatctc
accctcttctgctccgacgacgagtgcccctgggcgttcggcgatcgctgcttcatcgcc
acccctccccgccaccgccgccgccgccgccagccgcgtgttcccactgatgatgacaaa
caggaagcggacttgagggcgacgcggtggggcgccagggcgcgcgccgtggacaaggtg
atgctcgtctccggcacccgcaccaccgccgacgtgctgtggcaggacggcacgctgcgg
cgcggcgtgccgtcgctggagctggtgccgttcgacatcctcaacgaccacgagttcttc
ccgggccagcacgtcgtcgtcgacaccatggcggcggcggaagcaacgacggcggcggcg
aggcgcgtcggcgtcgtcaggagagtcgaccccaaggaccagacggtgcgcgtgtcgtgg
ctcgatggcggcgacggcggcggcgaggagaccgtggcgagcgcgtacgatctccgcaag
tactcccgccacgacgtgttctacggagacgtcgtcgtccggctgctcccgccgccgccg
gaatcagccgacgccgccggcgagggagcagcaccaccggcacagggcaccaaagccgcc
gccgccgacctttcatgggtcgggcgtgtcgtcgacgtccgcgacggccacgtccaagtc
cggtggggcaacggcgagacatcaacggcggtgcacagcgaggtacgcggcgtcgacatg
cggagcttctgggcgctggagcacgaggacgcagctgctcctgctccggatgctgctgct
ctgccaagcagcagcgacgcaggtggcggcgacggcgacggtgacggcgatggcggtgac
tccgccagcgacggcggatggaaggagaaggtggaggatgattcgctcggcgtcgcgcac
ttcgacgtcgtgcagtgcccgcctgatcaccatttcctggattgcaagctagagggtgct
gctcatggaaacaaatgggtaaagagagtccaaaaagaatggcagatattgggcaacgat
aacttaccagggactatatatgtgcgcgcgttcgaagaccggatggacttgctccgggca
gcgatggtgggcgccgccggctcgccgtaccacgacggcctcttcctcttcgacctccac
ctcccggcgacctacccggcggcgccgccggaggtgtactaccactcgttcggcctccgc
gtgaaccccaacctctacccctcgggcaccgtctgcctcagcctcctcaacacgttcgac
ggcgagggcgtcgaggtgtggtcgccggcgaggtcgacgctgctccaggtgctcgtctcc
atccagggcctcgtcctcaccgccgacccctactacaacgaggccggctacgacgcctac
gccggcacgccggggggccgccggaacgccgcctcctacgccgagaacgcctgcctgctc
acgctccggagcgcgctccacctcctccgccgcccgccgcggggcttcgagggcgtcgtc
ggggcacacttccgccgccgcggcgcccacgtgctcgccgcctgcgagtcgtacctgcgg
ggaacgcgcgtcgccggagacgggggagacggcggcggcggcgagaggacgtgctcggcg
gggttcaggctcgcgctgcgcaacgtcgtgccggtgctcgcggcggcgttcgcggagatc
ggcgtcgaggggtgtgagcggttcggcgacggcgagctcggacagtgctctctcaccgcc
attgatgacagcgctgctagcgctgatgcttcagattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324280
Entry
4324280           CDS       T01015                                 
Name
(RefSeq) baculoviral IAP repeat-containing protein 6 isoform X1
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4324280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4324280
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     4324280
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4324280
SSDB
Motif
Pfam: UQ_con UEV
Other DBs
NCBI-GeneID: 4324280
NCBI-ProteinID: XP_015621946
LinkDB
Position
1:7340663..7345354
AA seq 500 aa
MDFGYVGVGQGSSSSSSSASCRAADVAAWGSSTQQQQKRQRCQVVSRDHPGGLFRLVPGS
SDDQVGLSTSNSLQMSEPEPRDFDNGENEEEDYYLDEDDCIYDDGDGYDYEFDGGDYFNQ
RLADKFDDLDLPPGVEATVPWLQKIITNEEQSSSKLTVEDESANKSANKSQLFKQFDTVK
NFSDHHYAATSGDVTKRDWVKRIQHDWKLLEKDLPASIYVRVAEDRMDLLRAAIIGPKGT
PYHDGLFFFDIQFSNSYPANPPSVYYHSGGLRINPNLYNNGKVCLSLLGTWAGSGCETWN
PSQSTMLQVLVSIQALILNEKPYFNEPGYASYANSVSGERIAMEYNDNTFLHSCRTMLYS
LRRPPEHFADLVTSHFRERGHTILAACRYYMEGHKVGSVVPEEKEPEYGDAGASTSSASA
SAAAAALKPRPDKVDSVSRRPTFNDNLKTLFEELLMEFNVKGADTAKFLAEKVKKSSGAT
TTAPVGGARYAAEVVDEWMD
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggacttcgggtacgtcggcgtggggcaggggagctcgtcgtcgtcgtcgtcggcgtcg
tgccgagcggcggacgtggcggcgtggggatcctccacccagcagcagcagaagcggcag
cggtgccaggtcgtgagtcgtgaccaccccggcggcctgttccgtctcgtccccggttct
tctgatgaccaagttggattgagcacaagtaattctttgcaaatgtcagaaccagagcct
cgagattttgataatggagaaaatgaggaagaagattactatctggacgaggacgattgc
atttatgatgatggcgatggatatgattatgaatttgatggcggtgactacttcaaccaa
cgtcttgctgataaatttgatgatttggatttgcctccaggcgtggaggctactgtacct
tggcttcagaaaattataactaacgaagagcaaagcagttccaaattgacagttgaagat
gaaagcgcaaataaaagtgcaaataaatctcagttgttcaaacagtttgacactgttaaa
aatttctctgatcatcattatgcagcaacatcaggggatgtgacaaagagagactgggtg
aagaggattcagcatgactggaaacttttggagaaagatctaccagcatctatttatgtc
cgtgttgctgaagatagaatggaccttcttagggctgctattatcggacctaagggaaca
ccgtaccacgatgggctcttcttctttgatattcaatttagtaactcttaccctgctaat
cctccatcagtatactaccactctggcggactacggattaacccaaacttatacaataat
ggaaaagtatgccttagtcttcttggtacctgggcaggtagtggttgtgagacgtggaat
ccatctcagtcgaccatgctacaagtgctcgtctccattcaagctctcattttgaatgag
aagccctacttcaatgagccaggatatgcatcctacgccaatagtgtatctggagagcgg
attgctatggagtataacgacaacacatttctgcactcatgcaggacgatgctctactca
cttcggcggcctccagagcacttcgcagaccttgttaccagccacttcagggagcgcggg
cacaccatcctggcagcatgcaggtactacatggaaggccacaaggtcggatcggtggtc
cccgaagagaaggagccggagtacggcgacgcgggagcatccaccagcagcgccagcgcc
agcgccgccgccgccgctctgaagccgcggccggacaaggtggattccgtcagtagacgc
cccacgttcaacgacaacctcaagacgctgttcgaggagctcctgatggagttcaacgtg
aagggcgccgacacggccaagttcctcgccgagaaggtgaagaagagctctggtgcaaca
actactgcgcctgtaggaggcgcccgttatgcagcagaagtggtggatgagtggatggat
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324290
Entry
4324290           CDS       T01015                                 
Name
(RefSeq) putative ubiquitin-conjugating enzyme E2 39 isoform X1
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4324290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4324290
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     4324290
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4324290
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 4324290
NCBI-ProteinID: XP_015650019
UniProt: Q5NAX2
LinkDB
Position
1:complement(7404896..7409700)
AA seq 374 aa
MVLNKVLELFCVKKKDSKKKGKAINPLCKVAAPHPTANVSTNNSLLDPFSSGNGTVLLVQ
KHEPECSSVVSSMTRTEYGSESDGYNLFNQFDVVQDFSDHYYAKNSPGKTSKDWVKTIQN
EWKLLQKDLPESIYVRAYEDRIDLLRAAIVGPAGTPYHDGLFFFDVRFPSEYPQSPPKVH
YHSGGLRLNPNLYESGKVCLSLLNTWWGTGCEKWGKSKSTILQVLVSIQGLVLNDKPYFN
EPGNKNSANTAPGEKYSLAYNQTAFLLSCRTMMYSLRKPPKHFESLVARHFHERERVILD
ACDAYISGAVVGSSSAKGTKHPRDNNRSFADFKKSLEKYSELLRKDLAANRTHFLKLTRD
SPAAADEIVECTSS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggttctaaacaaggtgctcgagctgttttgtgtgaagaagaaggattccaagaagaaa
ggcaaagccattaatcctctttgtaaagttgccgctccacaccccactgcaaatgtcagt
acaaacaacagccttttggatcccttttcaagtgggaatggtactgtgctattagtgcaa
aaacatgagcctgaatgttcaagtgttgtatcatcaatgacaaggacagaatatggatct
gaaagtgatggctacaatttgtttaaccaatttgatgttgtgcaagatttttctgatcat
tactatgcaaagaattcaccagggaagacctccaaagattgggtgaagacaatccaaaat
gaatggaagcttctacagaaagatctacctgaatctatctatgttagagcttatgaggat
aggattgatctgctgagggctgctattgttgggccagctggaactccatatcatgatggt
ctgttcttctttgatgttcgctttccttctgaatacccacaatctccaccgaaagttcat
taccattcgggtgggcttcggctaaatccaaacttgtatgagagtgggaaagtttgcctt
agcctgctgaacacctggtggggtactggatgcgagaagtggggcaagtcaaaatcaacc
atactgcaggtgctggtttccatccagggtcttgtgttgaatgataaaccatactttaat
gagccaggcaacaaaaattcggctaatacagctcctggagaaaagtactcgttggcttat
aatcagactgccttcctactatcctgcaggacaatgatgtattcacttcggaagcctcca
aagcattttgagtcccttgttgcacgccacttccatgagcgtgagcgcgtcatcctggat
gcgtgcgacgcatacatatctggcgcagtcgttggatcatcctctgcgaagggcaccaag
catccccgcgacaacaacagatcgtttgcagatttcaagaagtcactggagaagtactct
gaactgctcaggaaggacttggccgcgaaccgcacacacttcctgaaactgacaagagac
tcgccggctgccgcagatgagatcgttgagtgtaccagcagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326008
Entry
4326008           CDS       T01015                                 
Name
(RefSeq) probable ubiquitin-conjugating enzyme E2 23 isoform X1
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4326008
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4326008
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     4326008
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4326008
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 4326008
NCBI-ProteinID: XP_015620122
LinkDB
Position
1:1421693..1427945
AA seq 1089 aa
MENLPNGSANIAEKNQDNEMSTDAGEPEEVADIFIYREDVVSLKSKEDTRGLVLEVAGEY
DSEGSITDDDTDTEEHEHKSSHRTENGGADGDNVSNGVDVDSQSSLPDNKVRVLWIDGVE
KTEDIDSVVVMDRSFLHGDIVASATDPTGQMGLVADVSLVVDLQGPHGEIIKGVSSKDLR
RIREFNVGDYVVSGPWLGRVDEVLDNVNVLFDDGSVCKVARADPMRLRPALGPLNPNASC
PFYPGQRVKAVNSSVYKTSRWLNGLWKASRLEGTVTKVETVAVIVYWIASAHFATNQESV
PPEEQNPKDLTLLSCFSYANWQLTDWCLPNQYTSSCTDDSLIESSEIKDSDDIPESSDVK
TELTQKTDMDENPGRMDGDSSADGSNMVYEDNTCLAKQSESGTIASTVPKEGSQDNATYR
KKLRKVFVKKDKRTRRRDESFERALLIANTYTKVDVIWQDGTKECGASSTLLIPIHSPND
HEFFPEQYVVDKVGNDVDDSSETKRVGLVRSVNAKDRTASVSWFKPSLHPEEPREIECNE
IVSAYELDGHPDYDYCYGDVVVRLPSVSLPVESTNRENTMELDNVNSTEVSATPVADAEE
QFPQKESSLEFTSLSWAGNIVGFEDGDIIVIWGDGSVSKVGPHEIYVVGREDDGASLDDG
TASDGASWETVDDNQTDLPDDSAQDDSQNVADSNIERENGSFNSQDGSSVATGPLSVAFG
FVTRLASELFARGKKHLDGSNSDAMDEVESHQSNEISESGDDIDKAEGENNVATSESTVV
TTNDASGGKSVDVDMADKPGDSDGFKHFDVQQCPPDHHYLENMAQQGTGGRKWVKKVQQE
WNILEKNLPDYIYVRVFEDRMDLIRAVIIGASGTPYQDGLFFFDFHLPPEFPQVPPSAYY
HSGGLRVNPNLYVDGKVCLSLLNTWTGRGNEVWDPSSSSILQVLVSLQGLVLNEKPYFNE
AGYEKQVGTVEGEKNALPYNENTYLLSLKSMLYILRRPPMHFEDFAKSHFSKRGKYILKA
CEAYLQGNGVGTLTDDACTTERSKEQPCSVGFKLALAKIMPRLITALKDAGANCDQYEHL
GKTETAQEH
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggaaaatctaccaaatggctcagcaaatatagctgagaagaaccaggataatgagatg
tctacagatgctggtgagcctgaagaagtagcagatatatttatttatagagaagatgtt
gtcagcttgaagtcaaaagaggacacccgtgggttggttttggaggtagcaggagaatat
gattctgaaggtagcatcactgatgatgatactgatactgaggagcatgaacacaaaagt
tctcataggactgaaaatggtggtgctgatggtgataatgtcagtaatggagttgatgtt
gatagtcagagttcattgcctgataacaaggttagggttctatggattgatggtgtcgag
aagacggaagatattgacagcgtggttgtcatggacagaagtttccttcatggagatata
gtggcttctgccacagatccaactggtcagatgggacttgttgctgatgtcagccttgtg
gttgatttgcaaggacctcacggagaaataataaagggagtatcctctaaagatttgaga
cgcatcagggaatttaacgtaggtgattatgttgtctctgggccatggcttggtcgagtc
gacgaggtgttggataatgttaatgtgttatttgatgacggctccgtctgtaaagtagcc
agggcagatcctatgcggctaaggccagcattggggccactgaatccaaatgcaagctgt
cccttttatcctggacagcgtgtcaaggcagtgaattcatctgtttacaaaacatccagg
tggctcaatggactatggaaagcaagtcgtcttgaaggcactgtcacaaaggtggaaaca
gttgcagttatagtctattggattgcatctgcacactttgccacgaatcaagaatctgtt
cctcctgaagagcagaacccaaaggatctgactcttttatcttgtttttcatatgcaaat
tggcaattaactgattggtgtcttcctaaccaatacacatcatcgtgtactgatgattct
ttgattgaaagttcagaaataaaagactctgatgacattcctgaatccagtgatgttaag
acagaactaacgcagaagactgatatggatgaaaaccctgggaggatggatggagattct
tctgctgatggatcaaatatggtttatgaagataacacatgcttagccaaacaatcagaa
tcaggcactattgcatcaaccgttccaaaggagggatcacaggacaatgcaacttacagg
aaaaaacttaggaaagtttttgtcaaaaaggataaaagaacaagaagaagagacgagagc
tttgaaagggctctgcttattgcaaatacatacacgaaggttgatgtgatctggcaagat
gggacaaaagaatgtggagcaagctcaacattgctcatcccgatccacagtccaaatgac
catgaattctttccggagcagtatgtcgtggacaaggttggtaatgatgttgatgattct
tctgaaacaaaacgtgtgggtcttgttagaagtgttaatgcaaaggaccgaactgcatct
gtatcatggtttaagccttcattacacccagaggagcccagagaaatcgagtgcaatgaa
attgtgagtgcatatgaattggatggccatccagattatgattattgctatggagatgtt
gttgttcgcttgccatctgtttcactgcctgttgaatcaaccaatagggagaacaccatg
gaactggataatgtaaattctacagaagtatcggcaacccctgtagctgatgcagaggaa
cagtttccacagaaggaatccagtttggaatttactagcctttcatgggctggtaatata
gttggttttgaagacggtgatattatagtcatttggggcgatggttcagtgtcaaaggtt
ggtccacatgaaatatatgttgttggtcgtgaagatgatggtgcctcactagatgatgga
actgccagtgatggtgctagctgggagactgttgatgacaatcaaacggatttgcctgat
gattctgcacaggatgattcgcaaaatgtagcagatagtaacatcgaaagggaaaacggt
tcatttaattcgcaggatggaagctctgttgcaactggtccactttctgttgcttttggc
tttgtgactcggctcgcgagtgaactctttgctcgaggtaaaaagcatttagatggatca
aactcagatgctatggatgaagttgaatctcaccagtctaatgagatttcagaatctggt
gatgatattgataaagctgagggggagaacaatgtggcaacatctgagagtaccgttgta
acaacaaatgacgcttccggtgggaagtctgtagatgttgatatggctgacaagcctgga
gattcagatggcttcaaacactttgatgttcagcagtgccctccagaccatcattacctg
gaaaacatggcgcagcagggcactggtggaagaaagtgggtaaaaaaggtacagcaggaa
tggaacatacttgagaaaaatctaccagattatatttatgttagggtatttgaggatcga
atggacctcataagagccgtgattattggagcaagtggaacaccataccaagatggtctt
ttcttcttcgacttccaccttccacctgagtttccacaagttcctccgtcggcgtactat
cattctggaggtttgcgcgtaaatccaaacctgtatgtggatgggaaggtctgcttaagt
ctcttgaatacctggacgggcagagggaatgaagtatgggatccatcatcatccagtatt
ctccaagtcctggtttcacttcagggcttggttctaaatgaaaagccttattttaatgaa
gctggctatgagaagcaagttggtactgttgaaggggagaagaatgcattgccatataat
gagaacacatatctgctgagcttgaaatccatgttgtatatcctgaggcgacctccaatg
catttcgaggactttgcaaagagccacttctccaagcgtggcaaatacattctcaaagct
tgtgaggcctatttgcaaggtaatggggttgggacgctcacagatgatgcctgcaccacc
gagagaagcaaagaacagccatgctcggtgggtttcaaactcgcattagcaaaaattatg
ccacggttgattactgccctgaaggacgctggagcaaattgtgaccaatatgagcacctt
gggaaaacggaaactgctcaagaacactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338168
Entry
4338168           CDS       T01015                                 
Name
(RefSeq) probable ubiquitin-conjugating enzyme E2 26
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4338168
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4338168
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     4338168
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4338168
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 4338168
NCBI-ProteinID: XP_015637327
UniProt: Q0DJS7 A0A0P0WJH2
LinkDB
Position
5:8034103..8039418
AA seq 467 aa
MDAAGYPKMQGGGASSSSSSSASCRAADAAVWDAVQQQKRQRCQGSSSNDQVGLSTENNS
FQAPEPELQNSDCVEDEEEDYYLYDEDDVCYDDDGDYEFDETDFNQQLADKFDGLDLPPG
VEATVPWLQKKDIADGPSTFKSMAELDADITKKYEFFKQFDVVENFSDHHYADKPVGKTG
KDWTKRIQYDWKLLEKDLPASIYVRVSENRMDLLRAVIIGPQGTPYHDGLFFFDAQFTST
YPSTPPVVYYHSGGLRLNPNLYACGKVCLSLLGTWSGSGCEKWNSAHSTMLQVLVSIQAL
VLNENPYFNEPGYETYANSATGQKSAMDYNDTTFQYSCRTMLYSLRRSPQHFDALVAGHF
RHRGHAILAACKYYMEGHKVGSVVPNEDEEDAKQQDDTDAGGSGSSSGAKPQPEKPDLCK
GRAASFKTNMAVLFEELLMEFNVKGADTKKFCDEKLKKNQQAAAAAR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggacgccgcaggttacccgaagatgcaaggaggaggggcgtcctcctcgtcgtcgtcc
tcggcttcctgccgcgccgccgacgcagccgtgtgggacgcggtgcagcagcagaagcgg
cagcgctgccagggttcttcatccaatgatcaagttggactcagtactgaaaataattcc
ttccaagcacctgaacctgagctgcagaattctgactgtgtggaagatgaggaagaagat
tactatttgtatgatgaggatgatgtctgctatgatgatgatggagactatgaatttgat
gaaactgacttcaatcagcagctagctgataagtttgatggtttggatttgcctccggga
gtggaggctaccgttccatggctgcaaaaaaaggatattgctgatggacctagcactttc
aagtcaatggcagaactagatgctgatattactaagaaatatgaattctttaagcagttt
gatgttgttgagaatttttcggaccatcattatgctgataagcctgttgggaagacaggg
aaagactggacaaaaaggattcagtatgactggaaacttctggagaaagatttaccagca
tccatatatgtccgtgtgtctgaaaatcgaatggaccttctgagggctgtaataattgga
cctcaaggaacaccttaccatgatggccttttcttctttgatgctcaatttactagtact
tatccatctactcctccagtggtatattatcattctggagggcttcggctcaatccaaat
ttatatgcttgtggaaaagtctgtcttagcctgctaggcacctggtctggtagtggttgt
gagaagtggaactcagctcactcaactatgctacaggttttagtctccattcaagctctc
gtattgaatgagaacccatacttcaatgagccaggatatgagacctatgccaacagtgct
actggacagaagagtgccatggactataatgataccacatttcagtactcatgcaggacg
atgttatactcactccgtagatctccacagcactttgatgcccttgtagctggccacttc
cgccaccgtggtcatgccattctggctgcatgcaaatattacatggaaggtcataaggtt
gggtccgtagtccctaacgaggacgaggaggatgcgaagcagcaggacgacactgatgca
ggaggatccggcagcagcagcggagcaaagccgcagcctgaaaagccagacctgtgcaag
ggccgtgctgcatccttcaaaaccaacatggccgttctgtttgaggagctcttgatggaa
ttcaacgtcaagggtgctgacaccaagaagttctgcgatgagaagttgaagaagaaccag
caggctgctgctgctgctcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339578
Entry
4339578           CDS       T01015                                 
Name
(RefSeq) putative ubiquitin-conjugating enzyme E2 38
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4339578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4339578
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     4339578
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4339578
SSDB
Motif
Pfam: UQ_con RWD TetR_C_13
Other DBs
NCBI-GeneID: 4339578
NCBI-ProteinID: XP_015639534
UniProt: A0A0N7KL81
LinkDB
Position
5:complement(27729499..27738344)
AA seq 509 aa
MATHAPKGYLCAGSSSFDDPDVVEVTPAAAAAGGWSSGHQKRKRSQVVPHEVIELDADDD
PDGVVIIGEKSSVDKNKQAVGYPIDWLKHAKSSLAGEIAGPSSYPSKNPDILLGGLKIFQ
ENPFYNNIDDYAYEAFEEDYGYDEDEYDDYDYDSTLYESEYNFTLASKFDGLDIPPGVEA
PLPWLQTTAAEMANKTKPVNMMDDKIDEKYSAFKQFDTVDDHSDHYYSKPDLRKVQVVKK
PSKEWAKRIQHEWKVLEKDLPDTIFVRAYEDRMDLLRAVITGPAGTPYHDGLFFFDIYFP
PHYPSVPPLVNYRSGGLRLNPNLYACGKVCLSLLNTWSGSGCERWSPSNSTMLQVLVSVQ
ALVLNAKPYFNEPGYAMHANTPHGEKSSLTYNEDTFLLSCRTMLYSLRNPPKHFEDFIAG
HFRKYGQSILIACRAYLDGAQVGCLVGNGVQDVDEGDKSCSARFKSALKRLFEELLMEFT
VKGAECDKFLAEKAKAAASRAPADTTLRL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcgacccacgcccccaagggctacctctgcgcggggagctcgtcgttcgatgatccc
gacgtggtcgaggtgacgccggcggcggccgcggcaggggggtggagctccggccaccag
aagcggaagcggagtcaggttgttcctcatgaagtaattgaactggatgctgatgatgat
cctgatggagttgtgattattggtgaaaaatcatcagttgataagaataagcaagctgtt
ggatatcctatagactggctaaagcatgcaaagagtagtttggctggtgaaattgctggc
ccaagttcctacccatcaaaaaatcctgatatattacttggtggcctgaaaatatttcaa
gagaacccattttacaacaacattgatgactatgcttatgaggcatttgaagaagattat
ggttatgatgaagatgagtatgatgattacgattatgatagtacactttatgaaagtgaa
tataacttcactttggcttccaagtttgatggtttggatatcccacctggtgtggaggct
cctttaccatggttgcagacgactgcggcagagatggcaaataagaccaaacctgtgaac
atgatggatgataaaattgatgaaaaatacagtgcatttaagcaattcgatactgttgat
gatcacagtgatcattattattcgaagccagatttaagaaaggttcaggtagtgaaaaag
ccttcaaaagaatgggcaaagcgtattcagcacgagtggaaagttctagaaaaagattta
ccagataccatattcgtgagggcatatgaggatagaatggacctgcttagagctgttatt
acgggaccagcaggcactccctatcatgatggtctcttcttctttgacatttacttccct
cctcattatccgagtgtacctccactggtgaactatcggtctggtgggttgcggcttaat
ccaaacttgtatgcttgcgggaaggtgtgccttagcctgttgaacacctggtctggtagt
ggatgtgagaggtggagtccttcaaactcaacaatgctacaagtcctggtctcagttcag
gctttggtgttgaatgccaaaccttatttcaatgagcctggatatgccatgcatgctaat
acacctcatggcgagaagagttcattaacttataatgaagatactttcctgctatcctgc
aggacaatgctatattctctgcgaaatccaccaaagcattttgaggattttatcgccggt
catttccgcaagtatggccagagcatcctgatagcttgcagagcctatctggacggtgcc
caagttggatgtcttgttggaaatggtgtgcaggatgtcgatgagggcgacaagagctgc
tcggcgaggtttaagagcgcgctgaagagattatttgaggaacttctgatggaattcact
gtcaagggagcagagtgtgacaaattcctagctgagaaggccaaagccgcggcttctaga
gctccagcagacaccacattgaggctataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339579
Entry
4339579           CDS       T01015                                 
Name
(RefSeq) probable ubiquitin-conjugating enzyme E2 24 isoform X1
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4339579
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4339579
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     4339579
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4339579
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 4339579
NCBI-ProteinID: XP_015639644
LinkDB
Position
5:complement(27740050..27747945)
AA seq 887 aa
MTTYFVLGLGKMDLYAIDSDTESYAETSDSEEDQEECELTYCGHAQNILSSLDESIGKID
NFLSFERGFLHGDIVCSAADPSGQLGRVVGVDMLVDLETSSGDIIKHVNSKKLSRVRSFV
SGDCVVMGPWIGRVIRAFDLVTVVFSDGARCEMLLRDSEVLKPIPPILFEDAPYFYYPGQ
RVRIVHPSISKSGTWLCGSWKASRDEGVVSHVDVGLVHVNWITSVTNVWGGQSSSPPNFQ
DPKKLTLLSCFPYANWQLGDWCTLSDCEGSLWENSDKSCFMSMTWKSSSDTQTAIGTYGS
DYSQTYVVAKTKSSVDVLWQDGSTSLGLEPQSLVPVSTLGDHDFWPGQFILEKLTVEDNG
RCQRTGIVTSVDALERTVKVKWAVSVDSDTVSYGDGLTEETVSAYELVLHPDFSFFTGEV
IIRSAVNIENSEANLTNGTVAVSRESLDTSSAFLSCIGNVLGYNDEGLEVQWASGAISRV
QHFEIIALDRILDDSLESMIEEHTTDDLVDMAEQEKMHLEDTKSALEESAGDCTGSLRKA
TAFLFSKTAFNFLTNVASSLFGAHDSTFSSSVNADSQYQIVTTAELQPSAEDISEEKQTM
ELITQFEKPTLASENAMTKGFDVVTDCSDHHFVKEIGHENVKRGWVKKIQQEWSILQNDL
PDGIHVRVYEERMDLLRACLVGAAGTPYHDNLFFFDIFFPPDYPHEPPSVHYHSGGLRLN
PNLYESGKVCLSLLKTWAGTGSEVWDPENSTVLQLLLSLQALVLNEKPYFNEAGYDKFMG
KADGEKNSITYNENAFLLSCKSMTYILHKPPKHFENFVKEHFTCCAPHILDACKAYLGGD
LVGHARDSAYISDDGCKNSSTGFKIMLAKLLPKLVTTFSEAGIPCSP
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgacaacgtactttgttttagggctcggaaagatggatctatatgcaattgactcggac
actgagtcatacgctgaaactagtgacagtgaagaagaccaagaagaatgtgaacttaca
tactgtggtcatgcccagaacatcttgtccagcttggacgagagcattggaaagatcgat
aactttctaagttttgaaagaggatttctgcatggagacatagtttgctctgcagctgac
ccatcaggtcagctgggccgtgtagttggagttgatatgcttgttgacttggaaacgagc
tctggtgacataataaaacatgtcaacagcaagaaactttcaagagttagatcctttgtc
tctggtgattgtgtggtgatggggccatggattggacgggtgatcagggcatttgacctg
gtcactgttgtgttcagtgatggggcaaggtgtgaaatgctcttaagagattctgaggta
ctgaagcccattcctccaatcctttttgaagatgcaccttatttttactatccaggccaa
cgtgtgagaattgttcatccttccatttctaagtcgggtacatggttgtgtggatcatgg
aaagctagtagagatgaaggagtagtgtctcatgtcgacgttgggctggtacatgtgaac
tggatcacctcagtaacaaatgtttggggaggtcaatcatcaagtcctccaaactttcag
gacccaaagaagctcactttgctttcatgcttcccttatgccaattggcagttgggtgac
tggtgcactctttcggattgcgagggaagtctctgggaaaattctgacaaatcttgcttc
atgagtatgacctggaagtccagctccgacactcaaacggctatcggaacttatggttca
gattattctcaaacatatgttgttgcaaagacaaagagtagtgttgatgttttatggcaa
gatggaagtacatctcttggtttagaacctcaaagtttggttcctgtgagtactcttggt
gatcatgatttttggcctgggcaatttatccttgagaaattgacagttgaggataatggt
agatgccagcggactgggatagtgacaagtgtggatgcacttgaacggactgtaaaggta
aaatgggctgtttcagttgatagtgacactgtcagttatggagatggactcactgaggag
actgtgagtgcttatgagctagtattacacccagatttctccttcttcactggcgaagtc
attattagatctgctgtcaacatagaaaattctgaagcaaatcttaccaatggaaccgtg
gcagttagcagggagagcttggatacctcctctgccttcttatcatgtattggcaatgtt
cttggatacaatgatgaaggacttgaagtccaatgggctagtggtgcgatatctagggtt
cagcattttgaaattattgcattagataggattctagatgattctctagaatccatgatc
gaggagcacactactgatgatttggtagacatggctgagcaggagaaaatgcaccttgag
gatactaagagtgcgctggaagaatctgctggagactgtacaggatccttgcgcaaagcc
actgctttcctcttttccaagacagcatttaattttctgacaaatgtggcttctagtttg
tttggtgctcatgattcaacattttccagctcggtcaatgcagattctcagtatcaaatt
gtgacgacagcagaactgcagccatctgcagaagatatctctgaagagaaacagaccatg
gagctgataacacagtttgagaagccaacattagcttcagaaaatgccatgacaaaagga
tttgatgttgtgaccgactgttctgatcaccactttgtcaaagaaattggtcacgaaaat
gtcaaaagaggttgggtgaagaagatacaacaggaatggtcaatcttacaaaacgatctg
ccagatggtattcatgttagagtttatgaagaaaggatggacctcctgagggcatgcctt
gtaggtgcagctggaacaccttatcatgacaatcttttcttctttgatattttctttcct
cctgattatcctcatgagccaccttctgttcactaccattccggtggcctccgtttgaac
ccaaatttgtatgagtctggcaaagtgtgccttagcctgctcaaaacatgggcaggaact
ggtagtgaagtgtgggaccctgaaaattcaactgttcttcaactgctgctgtcccttcaa
gctcttgttctcaatgaaaaaccttacttcaatgaggctggctatgacaaattcatgggg
aaagcagatggagagaagaactccatcacttacaatgagaacgctttcctgctgtcatgc
aagtccatgacgtacattttacacaagccaccaaagcatttcgagaattttgtcaaggag
cacttcacttgttgcgcgccgcacattctggatgcctgcaaggcttatctcggcggcgat
cttgttggacatgctcgtgacagcgcctatatatcggatgacggatgcaagaactcctca
accggtttcaagataatgctagccaagctcttgccgaagcttgtcaccaccttctctgaa
gccggcatcccctgcagcccgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346643
Entry
4346643           CDS       T01015                                 
Name
(RefSeq) putative ubiquitin-conjugating enzyme E2 38
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4346643
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4346643
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     4346643
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4346643
SSDB
Motif
Pfam: UQ_con UEV
Other DBs
NCBI-GeneID: 4346643
NCBI-ProteinID: XP_015610951
UniProt: B9G2N5 Q69LG5
LinkDB
Position
9:complement(7017623..7021067)
AA seq 433 aa
MAEGEGSSSRRWALGDPDVVEVSPEAAAAARWSSARLKRKRTTVAHEIIDLDANDDPDGV
MIICEKASSHKSNHSVSHPSDWPKHPKSGLAEDVPGPSHQPGTSTVLPWGCTTPGRPRKH
KEIKTVDNKIDEKYKAFKQFDTVTDHSDHYYSMSGKGNVPEVKKPSKDWVRRIQHEWKVL
EKDLPGTIFVRVYEDRMELLRAVIVGPAGTPYHDGLFFFDVYFPSQYPKKPPLVNYRSGG
LRLNPNLYDSGKVCLSLLNTWSGHGCEKWNPSNSTMLQVLVSIQALVLNAKPYFNEPGYA
ASANTPQGEKMSMAYNESTFLLSCRTMLYSLRNPPKHFEDFARVHFCKYGRNILVGCKAY
MNGAQVGCLAGNGVQDVDEGDKSCSANFKGSLKTLFDELIKEFTRIGVHCHEFQPQRVNP
GSTRAKADTTLRL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcggagggggagggctcctcttccaggaggtgggcgttgggcgatccggatgtcgtc
gaggtgtcgccggaggcggcggcggcggcgcgttggagctccgcgcgcctgaagcggaag
cgcacgactgttgctcacgaaataattgatctcgacgccaatgatgatcctgatggagtt
atgataatttgtgagaaggcgtcgagtcacaagagtaatcattctgttagtcatccttcg
gattggccaaagcatccaaagagtggcttggctgaggatgttcctggtccaagccatcaa
cctggcacgagcacagttctaccatggggatgcacaactcctgggagaccacggaagcat
aaggaaattaaaaccgtggataataaaattgatgagaagtataaggcatttaagcagttt
gatactgttaccgaccacagtgatcactattattcaatgtcaggcaaagggaatgttcct
gaagtcaagaagccatccaaggactgggtgaggcggattcaacatgaatggaaagttctg
gagaaagatttgccaggtacaatttttgtacgagtttatgaggataggatggaactactt
agggctgtcattgttggaccggcaggcactccttaccatgatggacttttctttttcgat
gtatatttcccttcccagtatcccaagaaacctccactagtgaactaccgctcgggaggg
ttgcggcttaatccaaatctctatgatagcgggaaagtctgtcttagcctattgaacact
tggtctgggcatgggtgtgagaagtggaacccatccaattcaaccatgctgcaggtccta
gtctccattcaggccttggtgttgaatgcgaaaccttattttaatgaacctggttatgca
gcttctgctaacacaccccagggggagaaaatgtccatggcttataatgaatcgacattt
ctcctatcctgcagaacaatgctgtattctcttcggaatccaccgaagcattttgaagac
ttcgcaagggttcatttttgcaagtacgggcgcaatatcctcgtaggatgcaaggcctac
atgaatggtgcccaagttggatgccttgcaggaaacggagtgcaggatgttgatgaaggc
gacaaaagctgctcagcgaacttcaaaggctccttgaagacgttatttgatgaactcatc
aaggaatttacccggataggagttcattgccatgaattccagcctcagagggtgaatcct
gggtctaccagagccaaggcggacaccacattgaggctatga

DBGET integrated database retrieval system