KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276534
Entry
107276534         CDS       T01015                                 
Name
(RefSeq) syntaxin-related protein KNOLLE-like
  KO
K08486  syntaxin 1B/2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    107276534
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107276534
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107276534
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    107276534
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107276534
  Exosomal proteins of other body fluids (saliva and urine)
   107276534
SSDB
Motif
Pfam: Syntaxin SNARE VirB8
Other DBs
NCBI-GeneID: 107276534
NCBI-ProteinID: XP_015619443
UniProt: A0A0P0Y804
LinkDB
Position
12:complement(4698235..4699698)
AA seq 348 aa
MCGYLIKSKFQPNNSTSPSPSSLIEKKWKKKSAFFVAPDLRDRSQQSPPIAPKMNDLMTD
SFVGAAAAAAAPLDRQDGGGGPGDQKLEAFLREAEAAKDEMAALRDELSRLQAAHEASKA
LLRPGAPRAATQAALVRLIGSAGRLRARLASMDRRAPAPATTAATAGLRGRLQDLTAGVQ
VLRRQVSAERRGDAARCYLAVAGEAPTEEQLDRLVAAGGANTDAEAAVRAAMKSSSEAEE
VEGGLLELQQLFLDMAALVESQGARVDDIERHVAAAAGDVGAAEGELREAQRLRVAARRR
RLWLSAGLAVLLLVVLAAAAAALALALARRKGGATQLAADAADLAAFL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtgcggttatcttataaaatcaaaattccaaccaaacaactcgacctcgccgtcgccg
tcgtctttaatcgaaaagaaatggaaaaaaaagtcagcgttttttgttgccccagatttg
cgagatcgatctcagcaatctcccccaattgcgcccaagatgaacgatctcatgaccgac
tccttcgtcggcgcggccgctgcggcggcggcgccgctggatcggcaagacggcggcggg
ggtcccggcgaccagaagctcgaggcgttcctccgggaggcggaggccgccaaggacgag
atggcggcgctgcgcgacgagctgtcccgcctccaggccgcgcacgaggcgtccaaggcg
ctgctccgccccggcgcgccgcgcgccgccacgcaggccgcgctcgtccgcctcatcggc
tccgccggccgcctccgcgcgcggctggcgtccatggaccgccgcgcccccgccccggcc
accaccgccgccaccgccggcctgcgcggccgcctgcaggacctcaccgcgggcgtccag
gtcctccgccgccaggtctccgcggagcgccgcggcgacgcggcgcgctgctacctcgcc
gtcgccggggaggccccgaccgaggagcagctggaccggctcgtcgccgccggcggggcg
aacaccgacgccgaggcggcggtgcgggcggccatgaagtcctcctcggaggcggaggag
gtggagggcggcctcctcgagctgcagcagctgttcctcgacatggcggcgctggtggag
tcccagggcgcgcgcgtcgacgacatcgagcggcacgtggccgcggccgcgggcgacgtg
ggcgccgccgagggggagctgagggaggcccagcggctgcgcgtcgccgcgcggcggcgg
cgcctgtggttgtccgctggcctcgccgtgctgcttctcgtcgtcctcgccgcggcggcc
gccgcgttggcgctcgctctggcgcggcgcaagggcggcgcgacacagctcgccgccgac
gcggctgatctcgccgcgttcttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276918
Entry
107276918         CDS       T01015                                 
Name
(RefSeq) syntaxin-related protein KNOLLE-like
  KO
K08486  syntaxin 1B/2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    107276918
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107276918
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107276918
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    107276918
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107276918
  Exosomal proteins of other body fluids (saliva and urine)
   107276918
SSDB
Motif
Pfam: Syntaxin SNARE RasGAP_C Helo_like_N DUF2207 Piezo_RRas_bdg FUSC CwsA
Other DBs
NCBI-GeneID: 107276918
NCBI-ProteinID: XP_015631526
UniProt: Q84R43 A0A0P0W304
LinkDB
Position
3:30192863..30194135
AA seq 311 aa
MNDLMTKSFMSYVDLKKAAMKDLEAGGDGVELPEVGVTDERLKGFFQETEAVEEEMAAIR
DALARLNAANEEGKSLHQPDALRALRGRVNADIIAVLRRARDIRARLEAMDRANAAQRRL
SAGCREGTPLDRTRTALTAALRKKLKDLMLDFQALRQRIMSEYKDTVERRYYTLTGEVPE
EEVIERIISEGRSEELLCAAVAEHGKGAVLATVHEIQDRHDAAREVERSLLELHQVFLDM
AVVVESQGEQLDDIERHVNSATTYVQGGNKELRKAREHQRSSRKWLCIGIIILLLLVLLV
IVPIATSFKRS
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaacgacctcatgaccaagtcgttcatgagctacgtcgacctgaagaaggcggcgatg
aaggacctggaggcgggcggggatggcgtggagctccccgaggtgggcgtcaccgacgag
cgcctcaaggggttcttccaggagacggaggcggtggaggaggagatggccgccatccgc
gacgcgctggcgaggctcaacgccgccaacgaggagggcaagtcgctgcaccagcccgac
gccctccgcgcgctccgcggccgcgtcaacgccgacatcatcgccgtgctccgccgcgcg
cgcgacatccgcgccaggctcgaggccatggaccgcgccaacgcggcgcagcgcaggctc
tccgcgggctgccgcgagggcaccccgctcgaccgcacccgcaccgcgctcaccgccgcg
ctccggaagaagctcaaggacctcatgctcgacttccaggccctgcggcagcggatcatg
tccgagtacaaggacaccgtcgagcgccgctactacaccctcaccggcgaggtccccgag
gaggaggtgatcgagcgcatcatctccgagggacgcagcgaggagctcctgtgcgccgcc
gtggcggagcacggcaagggcgcggtgctggccacggtgcacgagatccaggaccgccac
gacgccgcccgcgaggtggagcgcagcctcctggagctccaccaggtgttcctcgacatg
gccgtggtggtggagtcccagggggagcagctcgacgacatcgagcgccacgtcaacagc
gccaccacctacgtccagggcggcaacaaggagctacgcaaggcccgcgagcaccagcgc
agcagccgcaagtggctctgcatcggcatcatcatcctgctgctcctcgtcctcctcgtc
atcgtgcccatcgccaccagcttcaagagatcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334356
Entry
4334356           CDS       T01015                                 
Name
(RefSeq) syntaxin-121
  KO
K08486  syntaxin 1B/2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4334356
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334356
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334356
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    4334356
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4334356
  Exosomal proteins of other body fluids (saliva and urine)
   4334356
SSDB
Motif
Pfam: Syntaxin SNARE DUF3377 RNF152_C Pox_EPC_I2-L1 DUF2116 T2SSF
Other DBs
NCBI-GeneID: 4334356
NCBI-ProteinID: XP_015628438
UniProt: Q6F3B4 A0A0P0W4H1
LinkDB
Position
3:32694531..32696015
AA seq 330 aa
MNNLFSSSWKRTGGGGGGDGDIESGGGVEMAPPPGAAAGASLDRFFEDVESIKDELRDLE
RIQRSLHDANEGGKSLHDAAAVRALRARMDADVAAAIKKAKVVKLRLESLDRANAANRSV
PGCGPGSSTDRTRTSVVAGLRKKLRDSMESFSSLRARISSEYRETVARRYYTVTGEQPDE
ATLDNLAETGEGERFLQRAIAEQGRGEVLGVVAEIQERHGAVAELERSLLELHQVFNDMA
VLVAAQGEQLDDIETHVGRARSFVDRGREQLVVARKHQKSTRKWTCIAIIILLVLILVVV
LPIVLKFVNNNKSSSSSPAPATPSPPPPTA
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaacaatctcttctctagctcgtggaagcgcaccggcggcggcggcggcggcgacggg
gatattgaatcgggcggcggcgtggagatggcgccgccgccgggggcggcggcgggggcg
agccttgataggttcttcgaggacgtggagtcgatcaaggacgagctccgcgacctggag
cggatccagcggtcgctccacgacgccaacgaggggggcaagtcgctgcacgacgcggcg
gcggtgcgcgcgctgcgggcgcgcatggacgccgacgtcgccgccgccatcaagaaggcc
aaggtggtgaagctccgcctcgagtcgctcgaccgcgccaacgccgccaaccgctccgtc
cccgggtgcggcccgggctcctccaccgaccgcacccgcacctccgtcgtcgccggcctc
cgcaagaagctccgcgactccatggaatccttctcctccctccgcgcccgcatctcctcc
gagtaccgggagaccgtggcgcggcggtactacaccgtcaccggcgagcagcccgacgag
gcgacgctcgacaacctcgccgagaccggggaaggggagcggttcctgcagcgcgcgatc
gccgagcagggccgcggcgaggtgctcggcgtggtcgccgagatccaggagcggcacggc
gccgtggcggagctggaacgctcgctgctcgagctccaccaggtgttcaacgacatggcc
gtgctggtggcggcgcagggggagcagctcgacgacatcgagacccatgtcggccgcgcg
cgctccttcgtcgaccgcggccgcgagcagctggtggtggcgcggaagcatcagaagagc
acccgcaagtggacctgcatcgccatcatcatcctgctcgtcctcatcctcgtcgtcgtc
ctccccatcgtgctcaagttcgtcaacaacaacaagagcagcagcagctcgccggcgccg
gcgacgccgtcgccgccgccgccaacggcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340257
Entry
4340257           CDS       T01015                                 
Name
(RefSeq) syntaxin-132
  KO
K08486  syntaxin 1B/2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4340257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4340257
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4340257
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    4340257
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4340257
  Exosomal proteins of other body fluids (saliva and urine)
   4340257
SSDB
Motif
Pfam: Syntaxin SNARE APC_N_CC Ribosomal_L19e T2SSF TDH Synaptobrevin MCPsignal Snapin_Pallidin
Other DBs
NCBI-GeneID: 4340257
NCBI-ProteinID: XP_015641400
UniProt: A0A0P0WSV5
LinkDB
Position
6:complement(3445031..3448339)
AA seq 305 aa
MRNLLTDSFELSKVDQAPANVDIELGLQGGMSSSAQPGFEGFFEQVREIEKLHETLTKLL
KDLQNSNEESKIVTKASAMKEIKKRMEKDVNEVTKTARLAKSKVEKLNKDNAANREKPGF
GKGSGVDRSRTTTTVSLTKRLRERISEFQTLREAIQKEYRDVVERRVFTVTGERADEETI
DKLIETGDSEQIFQRAIQEQGRGRVLDTLQEIQERHDAVKEIEQKLLELQQIFLDMSVLV
EAQGEILDNIESQVSGAAEHIQTGTNLLQKARFLQKNTRKWTCIGIVILLIIILIVVLSL
KPWSK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaggaaccttctcacggattcgtttgagctcagcaaagtggaccaagcccctgcaaat
gttgatatcgagctagggttgcagggtggcatgtccagttctgcgcagcctggctttgaa
ggcttctttgaacaggtcagggagatcgagaagctacatgaaacattgacaaagttactg
aaggaccttcagaactcaaatgaggagtcaaaaattgttaccaaggcatcagccatgaaa
gagattaaaaagcgcatggagaaggatgtcaatgaggtgacaaaaactgcacgtctggca
aaatcaaaagtagagaagttgaataaagacaatgctgcaaacagagaaaaaccaggcttc
ggtaagggttcgggagtggacagatcccggactacaaccactgtctcattgacaaagagg
ttgagagaacggatatctgagtttcagacattaagagaggcaatccagaaggaataccgg
gatgtagtggagcggcgcgttttcactgtcactggcgagcgtgctgacgaagagacaatt
gacaagctgatagaaactggggacagtgagcaaatttttcagagagctattcaggaacaa
ggccgtggaagggtgcttgacactctccaagaaattcaggaacggcatgatgcagtgaaa
gagatagagcagaagcttcttgagctgcaacagattttcctcgacatgtccgtgttggtt
gaggctcaaggcgagatcctggacaatatagagtcacaggtttcaggtgcagctgaacat
attcagactggaacaaacctcctccagaaagcaagatttctgcagaagaacacacggaaa
tggacctgcatagggattgtcatcctcctcataatcatcctcatcgtcgtcctctcctta
aagccgtggtctaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341413
Entry
4341413           CDS       T01015                                 
Name
(RefSeq) syntaxin-125
  KO
K08486  syntaxin 1B/2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4341413
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341413
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341413
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    4341413
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4341413
  Exosomal proteins of other body fluids (saliva and urine)
   4341413
SSDB
Motif
Pfam: Syntaxin SNARE ATG17_like Helo_like_N DUF6175
Other DBs
NCBI-GeneID: 4341413
NCBI-ProteinID: XP_015641157
LinkDB
Position
6:23184577..23186437
AA seq 378 aa
MHGALPQIGRERPYTSCRITSFMDGLHISFLGSSPIAILSSSPSNRSYVSSAHPLASSLL
LLLIHKRSSEMNDLFSSSSFKKYADASPASGVGGSDMEAGGEGVVNLDRFFEDVEGVKED
MKGLEALYKRLQSTNEETKTAHDARAVKALRSRMDGDVEQVLRRAKAVKGKLEALDRDNA
TSRKVPGCGPGSSTDRTRTSVVAGLGKKLKDIMDDFQGLRTRMAAEYKETVARRYYTVTG
EKAEDSTIDSLIESGESESFLQKAIQEQGRGQVMDTISEIQERHDAVKDIERSLLDLHQV
FLDMAALVEAQGHQLNDIESHVAHASSFVRRGTVELEVAREHQKSSRKWACVAVLAGIIL
IAVLILPVLINLRILTLR
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgcatggcgcgttgccacaaataggcagggagaggccctacacttcatgtcgaattact
agtttcatggacggactccatatatcctttcttggtagctcacccattgccattctttca
agctccccgtccaaccgatcgtacgtctcctcagctcatccgcttgcctcgtcgctgctg
ctgctgctgatccacaagcgttcgtcggagatgaacgacctgttctcgtcgagctcgttc
aagaagtatgcggacgcgagcccggcgagcggcgtcggcggcagcgacatggaggccggc
ggcgagggcgtggtgaacctggacaggttcttcgaggacgtggagggggtgaaggaggac
atgaaggggctggaggcgctgtacaagcggctgcagtcgacgaacgaggagacgaagacg
gcgcacgacgcccgcgccgtgaaggccctccgctcccgcatggacggcgacgtcgagcag
gtgctccgccgcgccaaggccgtcaagggcaagctcgaggccctcgacagagacaacgcc
acctcccgcaaggtccccggctgcggccccggctcctccaccgaccgcacccgcacctcc
gtcgtcgccggcctcggcaagaagctcaaggacatcatggacgacttccaggggctgagg
acgaggatggcggcggagtacaaggagacggtggcgaggaggtactacacggtgacgggg
gagaaggcggaggacagcacgatcgattcgctcatcgagtcgggggagagcgagtcgttc
ctgcagaaggcgatccaggagcaagggcgggggcaggtgatggacaccatctcggagatc
caggagcggcacgacgccgtcaaggacatcgagcgcagcctgctcgacctgcaccaggtg
ttcctcgacatggcggcgctcgtcgaggcccagggacaccagctcaacgacatcgagagc
cacgtcgcgcacgccagctccttcgtccgcaggggcaccgtcgagctcgaggtggcgcgg
gagcaccagaagagcagccgcaagtgggcgtgtgtcgccgtcctcgccggcatcatcctc
atcgccgtcctcatcctcccggtgctcatcaacctccgcatcttgacgctcagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342474
Entry
4342474           CDS       T01015                                 
Name
(RefSeq) syntaxin-132
  KO
K08486  syntaxin 1B/2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4342474
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342474
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342474
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    4342474
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4342474
  Exosomal proteins of other body fluids (saliva and urine)
   4342474
SSDB
Motif
Pfam: Syntaxin SNARE Vac_Fusion Virul_fac_BrkB DUF6548 Helo_like_N DUF1902 Fusion_gly Metal_resist DUF3671 DUF2116
Other DBs
NCBI-GeneID: 4342474
NCBI-ProteinID: XP_015647004
UniProt: Q7XIE2 B9FVN1
LinkDB
Position
7:complement(3446341..3450368)
AA seq 303 aa
MNNLLTDSFELPRGGSSRDGDIEMGMQADPSDNLKGFLKKVDAIESLIAKLTNLLHKLQT
ANEESKAVTKARDMKAIKQRMEKDIDEVGKIARMAKTKVDELEKDNLSNRQKPGCGKGSA
VDRSREQTTGAVKKKLKERMDDFQVLREAIRQEYRDVVERRVFTVTGSRPDEETVDNLIE
TGRSEQIFQEAIQQQGRGQILDTVAEIQERHDAVRDLERKLLELQQIFMDMAVLVDAQGD
MINNIETHVSNATNHIQQGVSALQNAKKLQKNSRKWMCYAIILLLIIVVIIVVAVIQPWK
KGA
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaacaatctcctcaccgattcgtttgagctccctcggggaggctcttcaagagatggg
gacattgaaatgggaatgcaagctgatccttcagacaatctaaaaggtttcttgaaaaag
gttgacgcaattgaaagcctaattgctaagctgacgaatctcttgcataagcttcagact
gcaaatgaggaatctaaagcggttacaaaagcaagggacatgaaagcaattaaacagagg
atggagaaagatattgatgaagtggggaaaatcgctcgcatggcaaagacaaaagttgat
gaattggaaaaagataacttatcaaacagacaaaagcctggatgtgggaaaggatctgcg
gtagatcgatcaagagaacagactactggagcagtgaaaaagaaattgaaggagcgcatg
gatgattttcaggttttgagagaagcaatccggcaggagtatcgtgatgtcgttgaaaga
agggtgtttacagtaactggtagtcgtcctgatgaagagacagttgacaatttaatagag
actggaagaagtgagcaaattttccaagaagctatccaacagcagggaagaggccaaata
ctggacactgttgcagagatacaggaacgtcacgatgctgtaagagatctagagaggaag
cttctggagttgcagcagatattcatggatatggcagttttggttgatgctcaaggagac
atgatcaacaacatagagacacatgtttcaaatgctaccaaccacatacaacaaggcgtc
agtgctctacagaacgcgaagaagctccagaagaactccaggaagtggatgtgctacgcc
atcatcctcctgctcatcatagtggtgatcattgtcgtcgccgtcatccagccatggaag
aagggtgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343440
Entry
4343440           CDS       T01015                                 
Name
(RefSeq) syntaxin-132 isoform X1
  KO
K08486  syntaxin 1B/2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4343440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343440
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4343440
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    4343440
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4343440
  Exosomal proteins of other body fluids (saliva and urine)
   4343440
SSDB
Motif
Pfam: Syntaxin SNARE ZapD CK2S MCPsignal Syntaxin_2 Lzipper-MIP1
Other DBs
NCBI-GeneID: 4343440
NCBI-ProteinID: XP_015644943
LinkDB
Position
7:20686839..20691038
AA seq 334 aa
MNNLLTNSFESERDIEMGYQNSKNKSDYGLEDFFQEVQEIETLLDKMSNINHKLQEANEE
SKSVTKASEMKAINKRMEKDINEVGKITRTIKVKLEEMDRNNLENRKKQGCEKGTGVDRS
RMSMTIALKNKLKERMKNFQNLRQIIQDEYRQGVARMVFTVTGEQPSDQVIDHLIETGSS
EQIFEKAIQGIGRGQVEYRVQLHQYIICSFHVIKAGNSYNSAQMFHNCTYLQIIATVKEI
HERHDVVMEIEKKLLELQQIFADMATLVDAQGETLNDIENQVQNAVDHIQRGTGELRTAK
RLQKKSRKCMFIAIIILLVIAAIVVLSILKPWAK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaacaatcttctgacgaattcttttgaatcggagagggacatcgagatggggtatcaa
aattcaaagaataaatcggattatgggcttgaggatttcttccaggaggttcaggagatt
gagacgttgttggacaagatgtccaatataaaccacaaacttcaggaagccaatgaggaa
tcaaaatccgtcactaaggcttccgaaatgaaagcaatcaacaagcgcatggagaaagat
atcaatgaagttgggaaaattacacgcaccataaaagtgaagttggaggagatggatagg
aataatcttgaaaacagaaaaaagcaagggtgtgaaaagggcacaggcgtagaccgatca
aggatgtcaatgaccattgcgctgaaaaataaactcaaagaaagaatgaaaaatttccag
aatctaagacaaattattcaagatgagtaccgacaaggcgttgcgaggatggttttcaca
gtcactggagagcagccttctgatcaggtgattgaccacctgattgagaccggcagcagt
gagcagatatttgagaaagcgattcagggaattgggagagggcaggttgaatatcgtgtt
cagcttcaccagtacattatatgttccttccatgtcattaaggctggcaattcttacaat
agtgctcaaatgtttcataattgcacatacttacagataatagccacggttaaagaaatc
catgaaaggcatgatgtagtcatggaaattgaaaaaaaacttcttgaattgcaacagatt
tttgcggatatggcaacactcgtcgacgcacaaggagagacattgaacgacatagagaac
caggttcaaaatgctgtggaccatatacaacgtggtacaggagagctgcgcacagctaag
agactgcagaagaagtcaaggaagtgcatgttcatcgcaatcatcatactcctggtcatt
gcagctattgtcgttctttcaatcttaaagccctgggctaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272269
Entry
9272269           CDS       T01015                                 
Name
(RefSeq) syntaxin-124
  KO
K08486  syntaxin 1B/2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9272269
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9272269
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9272269
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    9272269
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   9272269
  Exosomal proteins of other body fluids (saliva and urine)
   9272269
SSDB
Motif
Pfam: Syntaxin SNARE ATG17_like CD225 Helo_like_N DUF2203 Phage_holin_2_1 DUF4164
Other DBs
NCBI-GeneID: 9272269
NCBI-ProteinID: XP_015624037
UniProt: A3A4F5 Q6H8D0
LinkDB
Position
2:complement(6157848..6160290)
AA seq 311 aa
MNDLFSSGSFKKYADLKNQAALDDMESGGGGGGGGEGANLEQFFEEVEGVKGEMRGLEAL
HGRLQASHEGSKTAHDARAVRSLRARMDADVEQVLRRARAVKGRLQALDRANAASRKLPG
RGPGSSTDRTRSSIVSGLGTKLKDLMDDFQGLRSRMAEEYKETVARRYYTVTGEKAEEST
VEALISSGESETFLQKAIQEQGRGQVLDTISEIQERHDAVKEIERGLLDLHQVFLDMAAL
VEAQGHQLNDIESHVARANSFVRRGAVELETAREYQRSSRKWACIAILAGVVLVVIIVLP
IIVNLHLLTIR
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaacgacctcttctcgtcggggtcgttcaagaagtacgccgacctgaagaaccaggcg
gcgctcgacgacatggagtccggcggcggcggcggcggcggcggcgagggcgcgaacctg
gagcagttcttcgaggaggtggagggcgtgaagggggagatgcgggggctggaggcgctg
cacgggcggctgcaggcgtcgcacgaggggagcaagacggcgcacgacgcccgcgccgtg
aggtcgctccgcgcccgcatggacgccgacgtcgagcaggtgctccgccgcgccagggcc
gtgaaggggaggctccaggcgctcgaccgcgccaacgccgccagccgcaagctccccggc
cgcggccctggctcctccaccgaccgcacccgctcctccatcgtctccggcctcggcacc
aagctcaaggacctcatggacgacttccaggggctgaggagtcggatggcggaggagtac
aaggagacggtggcgcggcgatactacacggtgacgggggagaaagccgaggagagcacg
gtggaagccctcatctcgtcgggggagagcgagacgttcctgcagaaggcgatccaggaa
caagggcgcggccaggtgctcgacaccatctccgagatccaggagcggcacgacgccgtg
aaggagatcgagcgcggcctgctcgacctccaccaggtgttcctcgacatggcggcgctc
gtcgaggcccagggccaccagctcaacgacatcgagagccacgtcgcgcgcgccaactcc
ttcgtccgccgcggcgccgtcgagctcgagacggcgcgggagtaccagcggagcagccgc
aagtgggcatgcatcgccatcctcgccggtgttgtgctcgtcgtcatcatcgtccttccc
atcatcgtcaacctccacctcttgaccattagatag

DBGET integrated database retrieval system