KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276545
Entry
107276545         CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase SINA-like 10
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107276545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    107276545
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107276545
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    107276545
SSDB
Motif
Pfam: Sina zf-C3HC4_3 zf-Di19
Other DBs
NCBI-GeneID: 107276545
NCBI-ProteinID: XP_015622136
UniProt: A0A0P0UXX3
LinkDB
Position
1:complement(1333549..1336364)
AA seq 302 aa
MQMQFPHLATMMRLKKKGTMDNTGTPKRTRWSENKAQQDGKDETTKLTYSIERDALECPI
CFVPFEDRVYMCKNGHAACGSCYAKMNTMCPCCIEPIGNIRCRPLEKVLAAMSAPCRFST
SAYMRLIRASGCTEIVAYTERRNHEASCPHAPCVCPFDGCNYQGHLLYSHIQDEHATDAA
VVATGCLRGTGTTVTLHKSKPFHVLLHRGGSRVFLLLNGDNVLSGRSLSLVCISPPPPLP
NCELLYKIELGAVSRAPGELGLSMSGTVPCVRRLEGFDAKAFLFVPDSYWGSSGTISVTV
HL
NT seq 909 nt   +upstreamnt  +downstreamnt
atgcagatgcagttccctcacttagcaacaatgatgcgtttgaagaagaagggtacgatg
gataatactggtacgcccaagaggacgaggtggtcggagaacaaggctcagcaggacggg
aaagatgagacgaccaagctgacctactccatcgagcgtgacgcactggagtgtcccatt
tgcttcgttccttttgaagatcgagtttacatgtgcaagaacggccacgctgcgtgcggc
tcctgctacgccaagatgaacaccatgtgcccgtgctgcatcgagcccatcggtaacatc
cggtgcaggccgctggagaaggtgcttgcggccatgtctgctccctgcaggttcagcacg
agcgcctacatgaggttgatcagggcgagcggctgcacggagatcgtcgcctacaccgag
aggcggaatcacgaggcgtcgtgcccacacgccccgtgtgtctgcccgttcgacggctgc
aactaccagggacacttgctgtacagccacatccaggacgaacacgccacggacgccgcc
gtcgtcgccacaggctgtctccggggcaccggcaccaccgtgacgctgcacaagagcaag
ccgttccacgtgctcctccaccgcggcggcagccgcgtcttcctcctgctcaacggcgac
aacgtcctgtcgggccgctcgctgtcgctggtctgcatcagccctcctcccccgttgccc
aactgcgagctgctgtacaagattgagcttggcgccgtgtcgcgggcccccggcgagctc
ggtctgtccatgtcgggtaccgtcccgtgcgtccgccggctggaggggttcgacgcgaag
gcgttcctgttcgtgcccgattcttactggggctcgtccggcaccatctctgtcaccgtg
cacctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278300
Entry
107278300         CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase SINA-like 10
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107278300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    107278300
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107278300
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    107278300
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 107278300
NCBI-ProteinID: XP_015638510
LinkDB
Position
5
AA seq 262 aa
MASTAPVGEACQRRLAKPSEPAAPSTRAVVAVTGVTVEDADALECGVCFLPLRPPIFQCE
VGHVVCSPCRDKLAPAGRCHVCRVAVAGGEYRRCYALERLVDAIRVACPHAAHGCGATPA
YHALDAHRRACPHAPCHCPGERCGFVGSTVALQDHIAATHSWPCTTNVRAGETVSVHLRD
GLAFLRVHHHRRRGSATYSDHLIMLNVTREPYGRAVSVLCCSDLADGLPDREQSFQFMVP
RCVVGDDDEGGIQIHVRIIVIN
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcctccaccgctccggtcggcgaggcatgtcagcgtcggctagcgaagccctctgag
ccggcggcgccgtcgacacgcgccgttgtcgcggtgacgggcgtgacggtggaggacgcc
gacgcgctcgagtgcggcgtgtgcttcctcccgctgaggccgcccatcttccagtgcgag
gtggggcacgtcgtgtgctcgccgtgccgcgacaagctggcgccggcgggcaggtgccac
gtctgccgcgtcgccgtcgccggcggcgaataccggcgctgctacgcgctggaacgcctg
gtggacgccatccgcgtcgcgtgcccgcacgccgcgcacggctgcggcgccacgccggcg
taccacgccctcgacgcgcaccgccgcgcctgcccgcacgcgccgtgccactgccccggc
gagcgctgcggcttcgtcggctcgaccgtcgcgctccaggaccacatcgccgccacgcac
agctggccgtgcaccaccaacgtccgcgccggcgagacggtgagcgtccacctccgcgac
ggcctcgccttcctccgcgtccaccaccaccgccgccgcggcagcgccacctactccgac
cacctcatcatgctgaacgtgacgcgggagccgtacggccgcgccgtctccgtgctctgc
tgcagcgacctcgccgacggattgcccgatcgcgagcagagcttccagttcatggtgcca
aggtgcgtcgtcggagacgacgacgaaggtggcatccaaatccatgtccgtattatcgtc
atcaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278743
Entry
107278743         CDS       T01015                                 
Name
(RefSeq) putative E3 ubiquitin-protein ligase SINA-like 6
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107278743
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    107278743
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107278743
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    107278743
SSDB
Motif
Pfam: Sina zf-RING_UBOX DUF3295 zf-C3HC4_2 PPP4R2
Other DBs
NCBI-GeneID: 107278743
NCBI-ProteinID: XP_015636285
LinkDB
Position
1:1369159..1374328
AA seq 305 aa
MVSVSMGHNADKKQVVTIGMDVLDCPVCFEPFKPPIFQCSVGHFICSSCCNKLNKCPGCS
RTSFEHCLGMERIVESAVVPCTYAEHGCTNKMSRPELALNRTSATTERALHKITYFNKKS
HEQACSYEPCFCPDSGCGFSGSVATLWKHFTTQHKWPSTEFKYYTPFDLRVKPGAHFLRA
GDGQLFVMNMVSVEPVGHGVSLVCIQPNTSESSFRCNVVFSSFTGHHQISTLESVRCSSL
SDGLPKNYFCIVPKSPGGGAAVLLRITIDTKLVLEVEDEQEEEEDDDDYDEDEDEDDESD
DEDGN
NT seq 918 nt   +upstreamnt  +downstreamnt
atggtgagcgtgtcaatgggacataatgctgacaagaagcaggttgtcacaattggcatg
gacgtcttggactgccctgtctgctttgaacccttcaagcctccgattttccagtgttct
gtggggcatttcatctgctcctcttgctgcaacaagctgaataagtgccctgggtgctca
agaacctcctttgaacactgcttgggcatggagcgcattgtcgaatccgcagtggttcct
tgcacctacgccgagcatggatgcaccaacaagatgtcacgccctgaactagccctgaac
agaactagcgccacgacggagcgggcgctacacaagatcacctacttcaacaagaaaagc
catgagcaggcgtgctcctacgagccgtgcttctgcccggactctggctgcggcttcagc
gggtcagtggcgacgctctggaaacatttcaccactcaacacaagtggccgtccacggag
ttcaagtactatacaccgttcgacctcagagtcaaaccaggcgcccacttcctccgagct
ggcgatggtcagctcttcgtgatgaacatggtgtcggtggagccagtcggccatggggtc
tccctcgtctgcatccagccgaacacttcggagtccagtttcaggtgcaatgttgtcttc
tccagcttcacgggccatcaccagatctcgacgctggagtcagtcaggtgctcgtcgctg
tcggacgggcttccaaagaactacttctgcatcgtgcccaagtctcctggtggtggcgct
gccgtcttgctcagaatcaccatcgacactaagttggtgctcgaagtcgaggacgaacag
gaggaggaggaggacgatgacgactatgatgaggatgaggatgaggatgacgagagcgac
gacgaggatgggaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280903
Entry
107280903         CDS       T01015                                 
Name
(RefSeq) putative E3 ubiquitin-protein ligase SINA-like 9
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107280903
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    107280903
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107280903
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    107280903
SSDB
Motif
Pfam: Sina zf-RING_5 DUF4729
Other DBs
NCBI-GeneID: 107280903
NCBI-ProteinID: XP_015638509
UniProt: Q65XQ0
LinkDB
Position
5
AA seq 376 aa
MAASSSSSKRRAMGMAASDQGDTSAHAMKKPRVRVAPDSSASEDDTDEDHGHDEGDGGEE
EEEEEEPDGDGEEESQSYQDPLESDGDGVDEEASAGDMAASEPAAPSTRAAVAGVTVEDA
DALECGVCFLLLRPPIFQCEVGHVVCAPCRDTLAPAGRCYVCRVAVAGGEYRRCYALERL
VDAIRVACPHAAHGCAARPAYHDVEAHRLACPHGPCHCPGERCGFVGSTAALLDHFAATH
NWPCTTNVRAREVFDVRLHDGFNFLVVGGASRHHLVMMNMTREPLGRAITVLRIHPHATG
RIQCELSLSRHVVLGDSWGLYRSHYQKSVFDVGCSDLADGLPDAKQCFQFVVPRCVAGDD
DEGGTGIRINVLITVD
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcggcctcctcttccagctcgaagcggcgagccatgggcatggcggcgtcggaccaa
ggtgacacctccgcccacgccatgaagaagcctcgcgtccgtgtcgcgccggattcctca
gcttcggaggatgacaccgacgaggaccatggccatgacgaaggcgacggcggcgaggag
gaggaggaagaagaagaacctgacggtgatggcgaggaggagagccagagttatcaagat
cctttggagtctgatggcgatggtgtggacgaagaggcaagcgccggcgacatggctgcc
tccgagccggcggcgccgtcgacacgcgcggcggtggcgggcgtgacggtggaggacgcc
gacgcgctcgagtgcggcgtgtgcttcctcctgctgaggccgcccatcttccagtgcgag
gtgggccacgtcgtgtgcgcgccgtgccgcgacacgctggcgccggcgggcaggtgctac
gtctgccgcgtcgccgtcgccggcggcgagtaccggcgctgctacgcgctggagcgcctg
gtggacgccatccgcgtcgcgtgcccgcacgccgcccacggctgcgccgccaggccggcc
taccacgacgtcgaggcgcaccgcctcgcgtgcccgcacgggccttgccactgccccggc
gagcgctgcggcttcgtcggctcgaccgccgcgctcctcgaccacttcgccgccacgcac
aactggccgtgcaccaccaacgtcagggcccgcgaggtgttcgacgtccgcctccacgac
ggcttcaacttcctcgtcgtcggcggcgcctcgcgccaccacctggtcatgatgaacatg
acgcgggagccgctcggccgcgccatcaccgtgctccgcatacacccgcacgccacgggc
agaatccagtgcgagctctcgctctcgcgccatgtcgtccttggcgacagctggggcctc
tatcgcagccactaccagaagtccgtgttcgacgtaggttgcagcgacctcgccgatgga
ttgccggatgcaaagcagtgcttccagttcgtcgtgccaagatgcgtcgccggagacgac
gacgaaggtggcaccggcatccgaatcaatgtcctaattaccgtcgactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326047
Entry
4326047           CDS       T01015                                 
Name
(RefSeq) putative E3 ubiquitin-protein ligase SINA-like 6
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4326047
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4326047
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4326047
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    4326047
SSDB
Motif
Pfam: Sina DUF4729
Other DBs
NCBI-GeneID: 4326047
NCBI-ProteinID: XP_015640884
LinkDB
Position
1:1249870..1251425
AA seq 332 aa
MAEQNKRSSSAAENGHAGGKKARANVEVKQEEEEAEEGEMSQEEESAKTGPLVVATAMDD
PQIDVRIAVGLLHCHACLLPLKPPVFKCEAAHVVCSGCRGNHGQLCRRAAAYAHCAELDA
IVGAAKVACAHAPYGCDSYVVYGAAAEHQRACPCAPCSCPDPGCGFRGSPAALLGHFATD
HPWSVTQISYAKPCRLAVPLPRRCHVLVGEDDRAMFLVVSPSPCGVGVGAAVCVACVRAN
GDDAAAAQYKCKLWVEVPTNSDNMVMMTSKVRSSDLSGGFPAAEQGMFLVVPPELLHEVS
GETPILSIRIDRAAPAIAKPTTPRARSLRRLQ
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctgagcagaacaagaggagctcgtcggcggcggagaacggccacgccggcggcaag
aaggcgagggccaacgtcgaggtgaagcaggaggaagaggaggcggaggaaggagagatg
agccaagaagaagagagcgcaaagacggggcctctggtggtggccaccgccatggacgac
ccgcagatcgacgtcaggatcgccgtcggcttgctccactgccatgcctgcctcctcccc
ctcaagcctcccgtcttcaagtgcgaggcggcgcacgtggtgtgctccggctgccgcggc
aaccacggccagctctgccgccgcgccgccgcgtacgcccactgcgccgagctggacgcc
atcgtcggcgccgccaaggtggcgtgcgcccacgcgccgtacggctgcgacagctacgtc
gtgtacggcgcggccgccgagcaccagcgcgcgtgcccgtgcgcgccctgctcctgcccg
gaccccggctgcggcttccgcggctcgccggcggcgctcctcggccacttcgccaccgac
cacccctggtccgtcacgcagatcagctacgcgaagccgtgcaggctcgccgtgccgctg
ccccggcggtgccacgtcctcgtcggggaggacgaccgcgccatgttcctggtggtgtcc
ccgtccccgtgcggcgtcggcgtcggcgcggcggtgtgcgtggcgtgcgtccgggcgaac
ggcgacgacgcggcggcggcgcagtacaagtgcaagctgtgggtggaggtgccgaccaac
agcgacaacatggtgatgatgacgtccaaggtgaggagcagcgacctctccggcgggttc
ccggcggcggagcaggggatgttcttggtggtgccgccggagctgcttcacgaggtgtcc
ggcgagacgccgatcctcagcatccgcatcgatcgagctgctcccgccattgccaagccc
accactccacgagccaggtccctgaggagattgcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327774
Entry
4327774           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase SINAT5
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4327774
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4327774
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4327774
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    4327774
SSDB
Motif
Pfam: Sina zf-C3HC4_3 zf-C3HC4_2
Other DBs
NCBI-GeneID: 4327774
NCBI-ProteinID: XP_015633666
UniProt: Q5NAX7 A0A0P0V0B6
LinkDB
Position
1:complement(7450826..7453678)
AA seq 347 aa
MDVDSVECLSLPDSSSSSGAGAGGGGGGGGGGGVGAMDAADDVGLALHAHGALLAAAAAA
RAAACSKGGGGGGAAAGSGVHELLECPVCTNSMYPPIHQCQNGHTLCSTCKARVHNRCPT
CRQELGDIRCLALEKVAESLELPCKYCSLGCPEIFPYYSKIKHEAQCMFRPYNCPYAGSE
CAVVGDIPYLVAHLRDDHKVDMHSGCTFNHRYVKSNPREVENATWMLTVFHCFGQYFCLH
FEAFQLGMAPVYMAFLRFMGDENEARNYSYSLEVGANGRKMVWEGTPRSVRDSHRKVRDS
HDGLIIQRNMALFFSGGDRKELKLRITGRIWKEQQTPDGACIPNLCS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggacgtggacagcgtcgagtgcctgtcgctgccggactcctcctcctcctccggcgcc
ggcgccggcggcggagggggtgggggtgggggtgggggcgtaggcgccatggatgcggcg
gacgacgtcggcctcgcgctgcacgcgcacggcgcgctcctggcggccgcggcggccgcg
cgggcggcggcgtgctccaagggagggggagggggaggcgcggcggccgggagcggcgtg
cacgagctgctcgagtgccccgtctgcaccaactccatgtacccgccgatccaccagtgc
caaaatggacacactctgtgttccacctgcaaagctagggtgcacaaccgttgccctaca
tgcagacaagagcttggtgatatcaggtgtttggccctggagaaagtagctgaatcgctt
gagcttccctgtaagtactgctctttggggtgcccagagatcttcccatactacagcaag
ataaaacatgaagcgcagtgcatgtttagaccatacaattgcccttatgctggttctgag
tgtgctgtggtgggtgatatcccttatcttgttgcccatttgagggatgatcacaaagtt
gatatgcatagtggttgcacattcaaccatagatatgtcaagtccaacccacgagaagtc
gaaaatgccacctggatgctgacggtcttccactgtttcgggcaatacttctgcctgcac
tttgaggccttccagcttgggatggcaccagtctatatggcctttctccgtttcatgggt
gatgaaaatgaggcaaggaactatagctacagccttgaggtcggcgcaaacggcaggaaa
atggtatgggagggcaccccccgaagtgtccgggacagccaccggaaggtgcgggacagc
catgatggcctcatcatccagaggaacatggcgctgttcttctcggggggcgaccgaaag
gagctgaagctgaggatcaccggccggatctggaaggagcagcagaccccagacggtgcc
tgcataccaaatctctgtagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328179
Entry
4328179           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase SINAT2
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4328179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4328179
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4328179
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    4328179
SSDB
Motif
Pfam: Sina zf-C3HC4_3 zf-C3HC4_2 zf-RING_UBOX zf-RING_6 zf-RING_5 zinc-ribbons_6 zf-RING_4 YEATS
Other DBs
NCBI-GeneID: 4328179
NCBI-ProteinID: XP_015623254
UniProt: Q6Z6Z3 A3A2R2
LinkDB
Position
2:complement(1481239..1485125)
AA seq 308 aa
MAPGSSIVTDIPESDCVSDGLSEALTGIRLDGDSTCKPWSTSLVTVELSSLTGLNDLLEC
PVCTNSMRPPILQCPNGHTICSNCKHRVENHCPTCRQELGNIRCLALEKVAESLQLPCKY
QSLGCAEIHPYQNKLKHEELCRFRPYSCPYAGSECLIAGDVPMLVSHLINDHKVDLHEGC
TFNHRYVKSNPYEVENATWMLTVFKCFGQHFCLHFEAFLLGMAPVYMAFLRFMGEDSEAR
NFCYSLEVGGNGRKLTWQGIPRSIRDSHKKVRDSFDGLIIHRNMALFFSGGNRQELKLRV
TGRIWKEQ
NT seq 927 nt   +upstreamnt  +downstreamnt
atggccccaggaagcagcattgtgaccgatatccctgagtcggattgtgtatctgatggg
ctctctgaggcactcactggcattaggcttgatggagattctacatgcaagccctggtct
acatcacttgtcacagttgagctatcatcgctgacgggcttgaatgatttgctcgagtgt
ccagtctgcacaaactcaatgcgcccacctatactgcagtgcccaaatggtcacacaata
tgctctaactgcaagcatagggtggagaatcattgccctacttgtcgccaagaactgggt
aatatcagatgtttggctcttgagaaggtggctgagtcacttcagcttccatgcaaatat
caaagcctaggctgtgctgagattcatccttaccaaaacaaacttaagcatgaggagctc
tgcaggttcaggccatatagttgtccatatgcaggttcagaatgcctgattgctggcgat
gttccgatgcttgtctctcatctcataaacgaccataaggtggacttgcatgaaggctgc
acctttaaccaccgttatgtgaagtccaacccttatgaagtggaaaacgctacatggatg
ctgacggttttcaagtgttttggacagcacttctgcctgcattttgaggcattcctgctg
gggatggcaccagtgtacatggcgttcctgaggttcatgggcgaggacagcgaggcccgg
aacttctgctacagcctggaggtgggcgggaacgggcggaagctgacatggcagggcatc
ccccggagcatcagggacagccacaagaaggtccgggacagcttcgacggcctcatcatc
caccggaacatggccctcttcttctccggcggcaacaggcaggagctcaagctgcgggtt
accggccgcatctggaaggagcaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329066
Entry
4329066           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase SINAT5
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4329066
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4329066
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4329066
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    4329066
SSDB
Motif
Pfam: Sina zf-C3HC4_3 zf-C3HC4_2
Other DBs
NCBI-GeneID: 4329066
NCBI-ProteinID: XP_015626757
UniProt: Q6KAC3 Q0E1X5
LinkDB
Position
2:complement(11157150..11162124)
AA seq 349 aa
MDMASIECVSYSDSMDDDDDDGVGVGGVSHLPRPILVKPSSAAAAVNVVVVSAGSGGGAG
GGGGGVGVVAGAPAVPPATSVHELLECPVCTNSMYPPIHQCQNGHTLCSTCKTRVHNRCP
TCRQELGDIRCLALEKVAESLELPCKYYSLGCPEIFPYYSKLKHESQCNFRPYNCPYAGS
ECSVVGDIPFLVAHLRDDHKVDMHSGCTFNHRYVKSNPREVENATWMLTVFHCFGQYFCL
HFEAFQLGVAPVYMAFLRFMGDENDARNYSYSLEVGANGRKMIWEGTPRSIRDSHRKVRD
SHDGLIIQRNMALFFSGGERKELKLRVTGRIWKEQQNPDSGACIPNLFS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggacatggcgagcatcgagtgcgtctcctactccgacagcatggatgacgacgacgac
gatggcgtcggcgtcggcggcgtctcccacctgccacgccccatcctcgtcaagccctcc
tccgccgccgccgccgtcaacgtggtcgtcgtctccgcgggcagcggagggggcgcgggg
ggaggaggaggaggggtcggggtcgtggccggggcccccgccgtccccccggcgacgagc
gtccacgagctgctcgagtgccccgtctgcaccaactccatgtacccgcccatccaccag
tgccaaaatggtcatactctgtgttcaacctgcaaaacccgtgtgcacaaccgctgccca
acctgtcgacaggagcttggtgatattagatgtctagcattggagaaagtggctgaatcg
cttgagctaccctgcaaatattactcactaggttgtccagaaatctttccgtactacagc
aaactcaagcatgaatcacagtgcaatttcaggccatacaactgcccttatgctggctct
gaatgctcagttgtcggggatattcctttcctagttgctcatctgagggatgaccataaa
gttgacatgcactcagggtgcacattcaaccatcgctatgttaagtcaaaccccagagag
gtcgaaaatgctacttggatgttgactgtctttcactgctttgggcagtacttctgcttg
catttcgaggccttccaacttggagtggctccggtttacatggccttcctccgttttatg
ggcgacgaaaatgatgccaggaactatagttatagccttgaggttggcgcgaatggccgg
aagatgatatgggagggcactccccgcagcataagggacagccaccggaaggttagggac
agccatgacggcctcataattcagcggaacatggctctgttcttctcaggcggagagagg
aaagagttgaaattgcgggtcaccggccgaatctggaaggaacagcagaatcctgactcg
ggagcctgcattccaaacctattcagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337836
Entry
4337836           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase SINA-like 5
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4337836
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4337836
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4337836
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    4337836
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 4337836
NCBI-ProteinID: XP_015638511
UniProt: A0A0P0WI27
LinkDB
Position
5:3045783..3047239
AA seq 326 aa
MEESDGHDEEGDNGGDEPDQSPDGDDMEEEEERGGGVHGGEAEVETFHHSEQASSARPVV
AVAGVTVEDADALECGVCCLPLRPPIFQCEVGHVVCAPCRDKLAPAGRCHVCRAAVAGGE
YRRCHALERLVDAIRVACPHAAHGCGATPAYHALDAHRRACPHAPCRCPGESCGFAGSTA
ALLDHFAAAHAWPCVADVRAGETHRLHDGFNFHRVEHRGGGDHRLIMLNMTREPLGRAIS
VLCIHPHAAPAAEMQCELRLHVSRPADDAGGGLCISHYQKSVFHIGYSDLADGVPDRRRR
FQFVVPRHVVGGDNEDGVQIRVRIKY
NT seq 981 nt   +upstreamnt  +downstreamnt
atggaggagagtgatggccacgacgaggaaggtgacaatggcggagacgagcctgatcaa
tcacctgatggtgatgatatggaggaagaagaggaaagaggcggcggcgtccatggtggg
gaggcggaggtagagacgttccatcactccgagcaggcgtcgtcggcgcgcccggtggtc
gccgtcgccggcgtgacggtggaggacgccgacgcgctcgagtgcggcgtgtgctgcctc
ccgctgaggccgcccatcttccagtgcgaggtggggcacgtcgtgtgcgcgccgtgccgc
gacaagctggcgccggcggggaggtgccacgtctgccgcgccgccgtcgccggcggcgag
taccggcgctgccacgcgctggagcgcctggtggacgccatccgcgtggcgtgcccgcac
gccgcgcacggctgcggcgccacgccggcgtaccacgccctcgacgcgcaccgccgcgcg
tgcccgcacgcgccgtgccgctgccccggcgagtcctgcggcttcgccggctccaccgcc
gcgctcctcgaccacttcgccgccgcgcacgcctggccgtgcgtcgccgacgtcagggcc
ggcgagacgcaccgcctccacgacggcttcaacttccaccgcgtcgaacaccgcggcggc
ggcgaccaccgcctgatcatgctgaacatgacgcgcgagccgctcggccgcgccatctcc
gtgctctgcatccacccgcacgccgcgcccgccgccgagatgcagtgcgagctccggctg
cacgtctcgcgccccgccgacgacgccggcggcggcctgtgcatcagccactaccagaag
tcggtgttccacataggctacagcgacctcgccgacggcgtgccggatcgccggcggcgc
ttccagttcgtcgtgccgcgacatgtcgtcggaggagacaacgaggatggtgtccaaatc
cgtgtgcgtatcaagtattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340862
Entry
4340862           CDS       T01015                                 
Name
(RefSeq) putative E3 ubiquitin-protein ligase SINA-like 9 isoform X1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4340862
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4340862
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4340862
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    4340862
SSDB
Motif
Pfam: Sina zf-C3HC4_3 zf-C3HC4_2 zf-RING_UBOX zf-RING_14 zf-RING_10 zf-RING_5
Other DBs
NCBI-GeneID: 4340862
NCBI-ProteinID: XP_015641377
UniProt: Q0DCM6
LinkDB
Position
6:11867740..11870667
AA seq 321 aa
MAKFTLDDADDDPPVATARDKRKRDDGPADAEDEPPRARGSAVAGREPAAPGAEAEAAGR
RGPAEEMANGEVEGGLSVQIDPDVLDCSICFESLRPPLYQCQNGHVACFSCWSKLSNKCH
ICSRDAKFARNIALEKIVESIKSSCSYAKWGCCKFINYAQRDAHEEACLFAPSVCPISNC
GYRGFTGRWSGHFLTSHSSDVMRFIYGQPFEVNIEVSVPFLVFLGEDDHLFLLQNNNLTP
FGHAFSVVCLRSGNLNWMFSYQIEATSRKKPENRLQLKASVTNTRQWTGIYPSEAFLLVP
FDFCHSSNIVLNISIERYAVV
NT seq 966 nt   +upstreamnt  +downstreamnt
atggccaagttcaccctggacgacgccgacgacgaccctcccgtcgctaccgcccgcgac
aagaggaagcgcgacgatggccccgccgacgccgaggacgaaccccccagggcccggggt
tcggcggtcgcgggccgcgagccagcggcgcccggcgcggaggcggaggcggccgggcgg
cgcgggccggcggaggagatggccaacggggaggtcgagggtggcctcagcgtgcagatc
gaccctgacgtgctcgactgctccatctgcttcgagtccctccgccctcccctctaccag
tgccaaaatggccatgtagcatgcttttcctgctggtccaagctcagcaataagtgtcac
atttgttctcgcgatgccaaatttgctcgaaatattgcattggagaagattgttgagtca
atcaagtcctcttgctcatatgcaaagtggggttgctgcaagtttatcaactacgcacaa
agagatgctcatgaagaagcttgtctttttgctccttcagtgtgcccaatctctaattgt
ggatatagaggattcactggacgttggtcaggacacttccttaccagccatagttcagat
gttatgaggttcatctatggtcagccttttgaagtaaatattgaggtatcggtgcctttt
ctggtttttcttggagaggatgaccaccttttccttctccagaacaataacctgacgccc
ttcgggcatgcgttttcagtagtttgtcttaggagtggcaatctaaattggatgttctcc
taccaaattgaagcaactagtagaaagaaacctgaaaatagactgcaactgaaggcttct
gtcacaaatacaaggcagtggacaggtatttacccttcagaagctttccttttggtaccg
tttgacttctgccattctagcaacatagtactcaatatctccattgagagatatgccgtt
gtatga

DBGET integrated database retrieval system