KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276584
Entry
107276584         CDS       T01015                                 
Name
(RefSeq) putative quinone-oxidoreductase homolog, chloroplastic isoform X1
  KO
K00224  chloroplastic oxoene reductase [EC:1.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    107276584
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-
     107276584
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_N ADH_zinc_N Cytomega_UL20A ADH_N_2
Other DBs
NCBI-GeneID: 107276584
NCBI-ProteinID: XP_015636031
UniProt: Q7FA53
LinkDB
Position
4:17108014..17110627
AA seq 331 aa
MAAGGRPATMRAVQYGGYGGGAATLKFVEIPVPSLKKNEILIKIEAASLNQADWRIQKGL
MRPFHPKFPFIPVTDVSGEVIEVGSAIHEFKVGDKVVSKLNLWKAGGLAEYVAASESDTV
SRPAGISAADAAGLPVAGLTALQALSSIGTKFDGSGTGADVLITAASSGVGTYAVQLAKL
GNHRVTTTCGARNLDLVGSLGADEVLDYATPEGAALASPSGRKYDYIINLTDRGKWSVFR
PQLSSNGGRVVDVSPNLGNFLASVMTLFSRRKRLSLVILTLGKKELGFLLELMREGKLKT
VVDSRHPFEKAAEAWERSMSGHATGKVIVEM
NT seq 996 nt   +upstreamnt  +downstreamnt
atggccgccggcgggaggccggccaccatgcgtgccgtccagtacggcggctacggcggc
ggcgccgccacccttaagtttgtggaaatccctgttccttcactcaagaagaatgaaatt
ctcataaaaatagaagcagcaagcctcaaccaagctgattggaggattcagaaaggattg
atgcgcccgtttcacccaaaattcccatttatcccagtaacggatgtttctggggaggtc
attgaggttggctctgcgattcacgagttcaaagttggtgacaaagttgtctccaaactt
aacctctggaaagcaggaggcctggcagagtacgtggcggcatcggagagcgacaccgtg
tcccgccccgccggaatctccgccgccgacgcggcagggcttcccgtcgccggcctgacg
gctctccaggcgctgagctccatcggcaccaagttcgatggctcgggcaccggcgccgac
gtgctgatcaccgcggcctccagcggtgtcggcacgtacgccgtccagctggccaagctc
ggcaaccaccgcgtcaccaccacgtgcggcgcacgcaatctggacctcgtcggcagcctc
ggcgccgacgaggtcctcgactacgccaccccggagggggccgcgctcgcgagcccctcc
ggtaggaagtacgactacatcatcaacctcaccgaccgcggcaagtggtcggtgttcagg
ccgcagctgagcagcaacggtggcagggtcgtcgacgtgtcccccaacctcggcaacttc
ttggcgtcggtgatgacgctcttctcgcggaggaagaggctgtcgctggtgatcctgacg
ctggggaagaaggagctggggtttctcctcgagctgatgagggaagggaagctcaagacg
gtggtcgactcgcggcatccgttcgagaaggccgcggaggcgtgggagaggagcatgagc
ggccacgccaccgggaaggtcatcgtggagatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335574
Entry
4335574           CDS       T01015                                 
Name
(RefSeq) putative quinone-oxidoreductase homolog, chloroplastic
  KO
K00224  chloroplastic oxoene reductase [EC:1.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4335574
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-
     4335574
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_N ADH_zinc_N ADH_N_2
Other DBs
NCBI-GeneID: 4335574
NCBI-ProteinID: XP_015633898
UniProt: Q0JDX5 Q7XMU7
LinkDB
Position
4:17180151..17183507
AA seq 332 aa
MAAGERPATMRAVQYSGYGGGAAALKFVEIPVPSVKKDEVLVKVEAASINQSDLMTQKGM
MRPFHPKFPFIPVNNVSGEIVEVGSAVREFKVGDKVVSKLDFWTAGGLAEYVATSDKLTV
ARPAGISAADAAGVPVAGLTALQALKAIGTKFDGSGTSGGADVLITAASSGVGTYAVQLA
KLGNHRVTATCGARNLGLVAGLGADEVLDYKTPEGAALSSPSGKKYDYIVNISNKNKWSV
FKPRLSSHGRVVDVAPNFGNFVASVVTLFSRRKKLSLVSLKMSKEDLGLLLELMREGKLR
TVVDSRHPFEKAADAWARSLSGHATGKVIVEM
NT seq 999 nt   +upstreamnt  +downstreamnt
atggccgccggcgagaggccggcgaccatgcgcgccgtccagtacagtggctacggcggc
ggcgccgctgcccttaagtttgtggaaatccctgttccttctgtgaagaaggacgaagtt
ctcgtaaaagtagaagctgcaagcatcaatcaatccgatttgatgactcagaaagggatg
atgcgcccctttcacccgaaatttccatttattccagtaaataatgtgtccggagagatc
gttgaggttggctctgcagtacgcgagttcaaagttggtgataaagttgtctccaaacta
gacttctggacagcagggggccttgctgagtacgtggccacatcggacaagctcaccgtc
gctcgccctgccggaatctccgccgctgacgcggcgggtgtgcccgtcgccggcctgaca
gcgctccaggcgctcaaggccatcggcaccaagttcgacggctcgggcaccagcggcggc
gccgacgttctgatcaccgcggcctccagcggcgtgggcacgtacgccgtccagctcgcc
aagctcggcaaccaccgcgtcaccgccacatgcggcgcgcgcaacctcggcctcgtcgct
ggcctcggcgccgacgaggtcctcgactacaagaccccggagggggccgcgctgtcgagc
ccctccggcaagaagtacgactacatcgtcaacatcagtaacaagaacaagtggtcggtg
ttcaagccgcgcctgagcagccatggcagggtcgtcgacgtcgcccccaacttcggcaac
ttcgtggcgtcggtggtgacgctgttctcccggaggaagaagctgtcgctggtgagcctg
aagatgagcaaggaggacctggggttgctgctcgagctgatgcgggaagggaagctcagg
acggtggtcgactcgcggcatccgttcgagaaggcggcggacgcatgggcgaggagcctc
agcggccatgccactggaaaggtcatcgtggagatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335575
Entry
4335575           CDS       T01015                                 
Name
(RefSeq) putative quinone-oxidoreductase homolog, chloroplastic isoform X1
  KO
K00224  chloroplastic oxoene reductase [EC:1.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4335575
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-
     4335575
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N
Other DBs
NCBI-GeneID: 4335575
NCBI-ProteinID: XP_015635083
UniProt: A0A0P0W924
LinkDB
Position
4:17201086..17209017
AA seq 361 aa
MTAFIYHHRLTCSDNRRNSGIARDYGRRRRDSGHHARGAVHRLRRRRRCPQVSLQHVEIP
VPSVKKHEVLIKVEAASVNPIDWSIQKGMLRPFLPKFPFIPVTDVAGEIVEAGSAVHELK
VGDKVLSKLNFWKGGGLAEYVAAPESLTVVRPAGVSAVDAAGLPVAGLTALKALMSIGTK
FDGTGGTGANVLITAASGGVGTYAVQLAKLGNHRVTATCGARNMDLVRSLGADEVLDYNT
PQGAALTSSASDEKYDYIINTAMNVNWSAMKPTLSSRGRVVDITPNPGNYVAAMLTMFAR
KKITMMALMSLGKEEMRFLMELVGEGKLRTVVDSRCPFEKAAEAWEKSMGGHATGKVIVE
M
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgactgcattcatctatcatcatcgattgacttgttcagacaacaggagaaattcagga
attgctcgggattatggccgccggcggcgggattccggccaccatgcgcgcggtgcagta
caccggctacggcggcggcgccggtgccctcaagtttcacttcagcacgtggaaatccct
gttccttcggtgaagaaacatgaagttcttattaaagtcgaagctgcaagcgttaacccg
attgattggagtattcagaaagggatgctacgcccatttcttcccaagtttccatttatt
ccagtgactgatgttgccggggagattgtggaggctggttctgcagtacatgagctcaaa
gttggtgacaaagttttgtccaaactgaacttctggaaaggaggaggcctcgctgagtat
gtcgctgcaccggagagcctcaccgtcgtccgccccgccggagtttccgccgtcgacgcg
gccgggctgccggtcgcaggcctcacagctctcaaggccctcatgtccatcgggaccaaa
ttcgacggcaccggcggcaccggcgccaacgtgctgatcaccgctgcctccggcggcgtc
ggcacctacgccgtccagctcgccaagctcggcaaccaccgcgtcaccgccacctgcggc
gcccgcaacatggacctcgtccgctccctcggcgccgacgaggtcctcgactacaatacc
ccccaaggcgccgccctgacgagctcggcctccgacgagaagtacgactacatcatcaac
accgccatgaacgtcaactggtcggcgatgaagccgaccctgagcagccgtggtagggtg
gtggacataacaccaaaccccgggaactacgtcgcggcgatgctgaccatgtttgccagg
aagaagataaccatgatggccctcatgtcgctggggaaggaggagatgaggtttctgatg
gagctcgtcggagaagggaagctcaggacggtggtcgactcgcggtgtccgttcgagaag
gcggcggaggcgtgggagaagagcatgggcggccatgccacgggtaaggtcatcgtggag
atgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335599
Entry
4335599           CDS       T01015                                 
Name
(RefSeq) putative quinone-oxidoreductase homolog, chloroplastic
  KO
K00224  chloroplastic oxoene reductase [EC:1.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4335599
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-
     4335599
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N
Other DBs
NCBI-GeneID: 4335599
NCBI-ProteinID: XP_015636266
UniProt: Q7XVK0
LinkDB
Position
4:18168715..18172035
AA seq 336 aa
MAGAAATPPAMMRAVQYDASGGGAAGLKHVEVPVPSAKKNEVLLKLEAATINPVDWKIQK
GMLRPLLPRRLPFIPVTDVAGVVAGVGPGVNDFAVGDQVVAMLNSMNGGGLAEYAVAAAN
LTVKRTPNVSAAEGAGLPIAAGTALQALRSIGAKFDGTGEPLNVLVTAASGGVGLYAVQL
AKLANLHVTATCGARNAELVRGLGADEVLDYRTPEGAAMRSPSGRRYDGVVHCTVGVGWP
AFEPLMAPRGKVIDITPNFSAMLTSALHAVTLRRKRLVPLLLSPNKADLEFLVGLVGEGK
LRTVVDSRFPLGDAAKAWQKSIDGHATGKIVVEMEG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggccggagccgccgcgacgccgccggcgatgatgcgcgccgtgcagtacgacgccagc
ggcgggggagccgccgggctcaagcatgttgaagtcccggtcccttcggcaaagaagaac
gaggtgctgttgaagctggaggcagcgaccatcaatccagttgactggaagattcagaaa
gggatgctgcgtcctctgctgcctcgtagactgccttttatcccagtgaccgatgttgca
ggagtggttgctggtgttggtcccggagtgaatgatttcgcagtaggtgatcaagttgtc
gctatgttgaacagtatgaacggaggtggattggcagagtacgccgtggcggcagcgaac
ctgaccgtcaagaggacacccaacgtctcagcggccgagggcgccgggctgcccatcgcg
gcgggcacggcgctgcaggcgctgaggtccatcggcgccaagttcgacggcaccggcgag
ccgctgaacgtgctggtcaccgccgcctcgggcggcgtgggcctctacgccgtgcagctg
gccaagctggcgaacctccacgtgacggccacctgcggcgcccgcaacgcggagctcgtg
aggggcctgggcgccgacgaggtgctggactaccggacgcccgagggcgccgccatgcgc
agcccctcggggaggaggtacgacggcgtcgtgcactgcaccgtcggcgtcgggtggccg
gcgttcgagccgctgatggcgccccgcgggaaggtgatcgacatcacgcccaacttctca
gccatgctcacctcggcgctgcacgcggtgacgctgcggcggaagcggctggtgccgctg
ctgctgtcgccgaacaaggccgacctggagttcttggtcgggctggtgggggaagggaag
ctcaggacggtggtggactcgaggttcccgctgggcgacgcggcgaaggcgtggcagaag
agcatcgacggccacgccaccggcaagatagtcgttgagatggaagggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347491
Entry
4347491           CDS       T01015                                 
Name
(RefSeq) putative quinone-oxidoreductase homolog, chloroplastic
  KO
K00224  chloroplastic oxoene reductase [EC:1.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4347491
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-
     4347491
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_N ADH_zinc_N Epimerase
Other DBs
NCBI-GeneID: 4347491
NCBI-ProteinID: XP_015612598
UniProt: Q0J0P9 A0A0N7KR24
LinkDB
Position
9:19443073..19444928
AA seq 340 aa
MATSSRRMRAVQYDKYGGGAQALKHVEVPIPTPKKGEVLIKMEAGSINQVDWKFQKGVAR
PFMPNKFPFIPVYDLAGEVVELGRGVSSFKVGDKVIAINFPGGGGLAEYAVAQASRTAPR
PPEVSAAVGACLPIAAVTALVALRTAGVSLDAGDGGGGGAKKNVLVTAASGGVGHFAVQL
ASAAGHRVTATCGARNAGLVGGLGADKVLDYATPEGAALRSPSGRRYDAVVHCAAVAGLP
WSAFAPVLADAGVVVDLTPGAAAFATALRQRVTFSRKRLVPLFVSPTKEDMELVAGMVAE
GKLRAVIESRHPLSRAEEGWARSMAGHATGKIIVEMGDEQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggccacttcttctcggaggatgcgcgccgtgcagtacgacaagtacggcggtggagct
caagcactcaagcatgtggaggtaccgatcccgacgccgaagaaaggcgaggtgctgatc
aagatggaggccggcagcatcaaccaggtcgactggaagttccagaaaggtgtcgctcgc
ccgttcatgcccaacaagttccccttcatcccagtttatgatcttgccggagaggtcgtg
gagctgggccgcggcgtgagcagcttcaaggtcggcgacaaggtcatcgccatcaatttc
cctggcggcggcgggctcgccgagtacgcggtggcgcaggcgtcgcggacggcgccgcgg
ccgccggaggtgtctgcggccgtgggcgcgtgcctgccgatcgccgccgtcacggcgctc
gtggcgctgaggaccgccggtgtcagcttagacgccggcgacggcggcggcggcggcgcc
aagaagaacgtgctggtcaccgcggcgtccggcggcgtcggccacttcgcggtgcagctg
gcgagcgccgccgggcaccgcgtcacggcgacctgcggcgcgcgcaacgccggcctcgtc
ggcggcctcggcgccgacaaggtgctcgactacgccaccccggagggcgcggcgctgcgg
agcccctcggggcggaggtacgacgccgtggtgcactgcgcggcggtggcggggctcccg
tggtccgcgttcgcgccggtgctcgccgacgccggcgtggtcgtcgacctcacgccgggc
gccgcggccttcgccacggcgctgcggcagagggtgaccttctccaggaagaggctggtg
ccgctgttcgtgtcgccgacgaaggaggacatggagctcgtcgccggcatggtggcggaa
gggaagctcagggcggtgatcgagtcgaggcacccgctgagcagggcggaggagggctgg
gccaggagcatggcggggcacgccaccggcaagatcatcgtcgagatgggagacgaacag
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347496
Entry
4347496           CDS       T01015                                 
Name
(RefSeq) putative quinone-oxidoreductase homolog, chloroplastic
  KO
K00224  chloroplastic oxoene reductase [EC:1.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4347496
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-
     4347496
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N ADH_N_2
Other DBs
NCBI-GeneID: 4347496
NCBI-ProteinID: XP_015651421
UniProt: Q0J0N7 A0A0P0XPT8
LinkDB
Position
9:19468800..19471623
AA seq 346 aa
MAAAADAAPKTMRAVQYDKYGGGPEGLKHVEVPIPAPKEGELLIKMEAASINPIDWKIQK
GMLRLFLPKKFPFIPVGDLSGEVVELGGGVSGFKPGDKVVSMSFPNCGGLAEYAVAPASL
TVARPPEVSAADGATLPAAAGSALQQLKAAGVRFDADADAAAAAGGPKNVLVTAASGGVG
HYAVQLAKLAGLHVTATCGARNLAFVRDGLGADEALDYRTPDGAALRSPSGRRYDAVAHC
APPAPWPVFRDALADAGGVVVDLTPGVAATVRSFLHRVTFSKKRLVPLILMPKKEEMEWL
VDMAKQGKLKTTIDSKYPLSRAQEAWAKSMEGHATGKIVVEMGGTE
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggctgccgctgccgacgctgctccaaagacgatgagagctgtgcagtacgataagtac
ggcggaggaccagaaggcctcaagcatgtggaagtgccgatcccggcgccgaaggaaggg
gagttgctgatcaagatggaggcggcgagcatcaaccccatcgactggaagattcagaag
gggatgctccgcctcttcctgcccaagaaattccccttcattccagttggtgatctatcc
ggcgaggtggtggagctcggcggcggcgtgagcggcttcaagccgggagacaaggtcgtt
tccatgagcttcccgaactgcggcgggctcgccgagtacgcggtggcgccggcgtcgctc
acggtggcgaggccgcccgaggtgtccgcggccgatggcgccaccttgccggcggccgcg
ggctccgcgctccagcagctgaaggcggccggagtcaggttcgacgcggacgccgacgcc
gccgccgccgccggcggccccaagaacgtgctggtcaccgcggcgtcgggcggcgtgggc
cactacgccgttcagctcgccaagctcgccggcctccacgtcacggccacctgcggcgcc
cgcaacctcgccttcgtccgcgacggcctcggcgccgacgaggcgctcgactacaggacc
cccgacggcgccgcgctgcggagcccgtcgggcaggaggtacgacgcggtggcgcactgc
gcgccgccggcgccgtggccggtgttcagggacgccctggccgacgccggcggcgtcgtg
gtcgacctcacgccgggggtcgccgccaccgtcaggtcgttcctgcacagggtgaccttc
tccaagaagaggctcgtgccgctgatcctgatgcccaagaaggaggagatggagtggctg
gtcgacatggccaagcaagggaagctcaagaccaccatagattccaagtaccctctgagc
agagcacaggaggcttgggctaagagcatggaaggccatgccacgggcaagatcgttgta
gaaatgggaggcacagaatga

DBGET integrated database retrieval system