KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276598
Entry
107276598         CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107276598
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107276598
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    107276598
  Archaea
    107276598
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 107276598
NCBI-ProteinID: XP_015646105
UniProt: Q0D6R2 Q8H5N0
LinkDB
Position
7:20291745..20293893
AA seq 105 aa
MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKGTSLF
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaacgttcccaagaccaagaagacctactgcaagaacaaggagtgcaggaagcac
acccttcacaaggtcactcagtacaagaagggtaaggacagcctgtctgcccagggaaag
cgccgttatgaccgtaagcagtcaggatatggtggtcagaccaagcctgttttccacaag
aaggcaaaaaccaccaagaagattgtgctgaagctgcaatgccaaagctgcaagcattac
tcccagcaccccatcaagaggtgcaagcatttcgagattggtggagacaagaagggcaag
ggaacatctcttttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276599
Entry
107276599         CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107276599
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107276599
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    107276599
  Archaea
    107276599
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 107276599
NCBI-ProteinID: XP_015646111
UniProt: Q0D6R2 Q8H5N0
LinkDB
Position
7:20309963..20312111
AA seq 105 aa
MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKGTSLF
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaacgttcccaagaccaagaagacctactgcaagaacaaggagtgcaggaagcac
acccttcacaaggtcactcagtacaagaagggtaaggacagcctgtctgcccagggaaag
cgccgttatgaccgtaagcagtcaggatatggtggtcagaccaagcctgttttccacaag
aaggcaaaaaccaccaagaagattgtgctgaagctgcaatgccaaagctgcaagcattac
tcccagcaccccatcaagaggtgcaagcatttcgagattggtggagacaagaagggcaag
ggaacatctcttttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277606
Entry
107277606         CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44-like
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107277606
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107277606
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    107277606
  Archaea
    107277606
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 107277606
NCBI-ProteinID: XP_015646006
LinkDB
Position
7:20261853..20262896
AA seq 141 aa
MGSDDGMKSLRPDILVMTNISIFPEDPIEFLTIGLLNVNVPKTKKTYCKNKECRKHTLHK
VTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHP
IKRCKHFEIGGDKKGKGTSLF
NT seq 426 nt   +upstreamnt  +downstreamnt
atgggctccgatgatggcatgaaatctttgagacctgacattcttgtgatgacaaacata
agcatatttcctgaggacccaattgagtttttaaccattggtctgctgaatgtgaacgtt
cccaagaccaagaagacctactgcaagaacaaggagtgcaggaagcacacccttcacaag
gtcactcagtacaagaagggtaaggacagcctgtctgcccagggaaagcgccgttatgac
cgtaagcagtcaggatatggtggtcagaccaagcctgttttccacaagaaggcaaaaacc
accaagaagattgtgctgaagctgcaatgccaaagctgcaagcattactcccagcacccc
atcaagaggtgcaagcattttgaaattggtggagacaagaagggcaagggaacgtctctt
ttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107281656
Entry
107281656         CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107281656
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107281656
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    107281656
  Archaea
    107281656
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 107281656
NCBI-ProteinID: XP_015646109
UniProt: Q0D6R2 Q8H5N0
LinkDB
Position
7:20304201..20305872
AA seq 105 aa
MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKGTSLF
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaacgttcccaagaccaagaagacctactgcaagaacaaggagtgcaggaagcac
acccttcacaaggtcactcagtacaagaagggtaaggacagcctgtctgcccagggaaag
cgccgttatgaccgaaagcagtcaggatatggtggtcagaccaagcctgttttccacaag
aaggcaaaaaccaccaagaagatcgtgctgaagctgcaatgccaaagctgcaagcattac
tcccagcaccccatcaagaggtgcaagcatttcgagattggtggagacaagaagggcaag
ggaacatctcttttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343124
Entry
4343124           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343124
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4343124
  Archaea
    4343124
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 4343124
NCBI-ProteinID: XP_015647613
UniProt: Q0D6R2 Q8H5N0
LinkDB
Position
7:15448823..15451434
AA seq 105 aa
MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKGTSLF
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaacgtgccaaaaactaagaagacttactgtaagaacaaggaatgcaggaagcac
accctacacaaggttacccagtacaagaaaggaaaggatagcctttctgctcaggggaag
cgtcgttatgaccgcaagcagtcaggatatggtgggcagacaaagcctgtttttcacaag
aaggccaagacaacaaagaagatcgttctgaagctgcagtgccagagctgcaagcactac
tctcagcacccgatcaagaggtgcaagcactttgaaatcggtggagacaagaagggcaag
ggaacttcactcttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343415
Entry
4343415           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343415
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4343415
  Archaea
    4343415
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 4343415
NCBI-ProteinID: XP_015646005
UniProt: Q0D5Z3
LinkDB
Position
7:20257481..20258452
AA seq 133 aa
MGSNDGMKSLRPDILVMTNISIFPEDPIEVNVPKTKKTYCKNKECRKHTLHKVTQYKKGK
DSLSAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFE
IGGDKKGKGTSLF
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggctccaatgatggcatgaaatctttgagacctgacattcttgtgatgacaaacata
agcatatttcctgaggacccaattgaggtgaacgttcccaagaccaagaagacctactgc
aagaacaaggagtgcaggaagcacacccttcacaaggtcactcagtacaagaagggtaag
gacagcctgtctgcccagggaaagcgccgttatgaccgtaagcagtcaggatatggtggt
cagaccaagcctgttttccacaagaaggcaaaaaccaccaagaagatcgtgctgaagctg
caatgccaaagctgcaagcattactcccagcaccccatcaagaggtgcaagcatttcgag
attggtggagacaagaagggcaagggaacatctcttttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343416
Entry
4343416           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343416
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343416
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4343416
  Archaea
    4343416
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 4343416
NCBI-ProteinID: XP_015646106
UniProt: Q0D6R2 Q8H5N0
LinkDB
Position
7:20273528..20275676
AA seq 105 aa
MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKGTSLF
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaacgttcccaagaccaagaagacctactgcaagaacaaggagtgcaggaagcac
acccttcacaaggtcactcagtacaagaagggtaaggacagcctgtctgcccagggaaag
cgccgttatgaccgtaagcagtcaggatatggtggtcagaccaagcctgttttccacaag
aaggcaaaaaccaccaagaagattgtgctgaagctgcaatgccaaagctgcaagcattac
tcccagcaccccatcaagaggtgcaagcatttcgagattggtggagacaagaagggcaag
ggaacatctcttttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266960
Entry
9266960           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9266960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9266960
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9266960
  Archaea
    9266960
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 9266960
NCBI-ProteinID: XP_015646110
UniProt: Q0D6R2 Q8H5N0
LinkDB
Position
7:20267764..20269436
AA seq 105 aa
MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKGTSLF
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaacgttcccaagaccaagaagacctactgcaagaacaaggagtgcaggaagcac
acccttcacaaggtcactcagtacaagaagggtaaggacagcctgtctgcccagggaaag
cgccgttatgaccgaaagcagtcaggatatggtggtcagaccaagcctgttttccacaag
aaggcaaaaaccaccaagaagatcgtgctgaagctgcaatgccaaagctgcaagcattac
tcccagcaccccatcaagaggtgcaagcatttcgagattggtggagacaagaagggcaag
ggaacatctcttttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271813
Entry
9271813           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9271813
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9271813
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9271813
  Archaea
    9271813
SSDB
Motif
Pfam: Ribosomal_L44
Other DBs
NCBI-GeneID: 9271813
NCBI-ProteinID: XP_015646107
UniProt: Q0D6R2 Q8H5N0
LinkDB
Position
7:20285982..20287653
AA seq 105 aa
MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKGTSLF
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaacgttcccaagaccaagaagacctactgcaagaacaaggagtgcaggaagcac
acccttcacaaggtcactcagtacaagaagggtaaggacagcctgtctgcccagggaaag
cgccgttatgaccgaaagcagtcaggatatggtggtcagaccaagcctgttttccacaag
aaggcaaaaaccaccaagaagatcgtgctgaagctgcaatgccaaagctgcaagcattac
tcccagcaccccatcaagaggtgcaagcatttcgagattggtggagacaagaagggcaag
ggaacatctcttttctaa

DBGET integrated database retrieval system