KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276997
Entry
107276997         CDS       T01015                                 
Name
(RefSeq) alpha-L-arabinofuranosidase 1-like
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107276997
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     107276997
SSDB
Motif
Pfam: Alpha-L-AF_C CBM_4_9
Other DBs
NCBI-GeneID: 107276997
NCBI-ProteinID: XP_015635005
LinkDB
Position
4:complement(11502182..11510631)
AA seq 667 aa
MLACKVSRGSKQLMGSKEAFRRIIFCVLLLLCVSCKCLTSEVNTTQLAVLKVDASPQHAR
KIPETLFGIFFEEINHAGAGGIWAELVSNRGFEAGGPNTPSSIDPWSIIGNESVISVATD
RSSCFSRNIIALRMEVLCGDCQAGGVGIYNPGFWGMNIEDGKNYSLVMYAKSLENTELTV
SLTSSDGLQNLSSATIQVAGTSNWTKLEQKLVAKGTNRTSRLQITTNKKGVIWLDQISLM
PSDTYKGHGFRKELVSMLLDLKPQFMRFPGGCFVEGQWLRNAFRWRESVGPWEERPGHFG
DVWGYWTDDGLGYYEFLQLSEDLGAAPIWVFNNGFSHNEEINTTAIAPFVKDILDSLEFA
RGSTNSTWGSLRVAMGHPEPFPVKYVTIGNEDCTKKFYHGNYLKFHRAIREAYPDIQIIS
NCDGSSKPLDHPADIYDFHVYGDSNTLFSMRNKFDSTPRNGTKAFVSEYAVSSNGVGRGT
LLASLAEAAFLTGLEKNSDVVQMASYAPLFMNDNDLSWNPAAVVFNSWKQYGSPSYWMQT
IFRESSGAVLHPVTINSMYSNSLAASAITWKASNSSFLRVKIVNIGSNPVNLIVSTTGLE
ALVNMRKSTITILTSKNLSDENSFSKPTNVVPVTRELPNAGEEMFAFLGPYSFTSFDLAL
GQQKHVS
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgctagcatgcaaagtttcacgtgggagcaagcaactaatgggctccaaagaagcattc
cgacgtatcatattctgcgtcttgcttctactctgtgtgagctgcaaatgcttaacctca
gaggtaaacacaacccaactggcagtcctcaaggttgatgcctcaccgcagcatgctcga
aagatccctgagacactctttgggatatttttcgaggagatcaaccatgctggagcaggt
ggaatatgggcagagcttgtcagcaacagaggtttcgaagctggaggccctaatactcca
tcgagcattgacccttggtccataattggaaatgaatctgtcatatcagtggcaactgat
cgatcatcatgtttcagtcgaaatatcattgctctgaggatggaggttctctgtggtgac
tgccaagctggtggtgttggcatttacaatccaggattctggggcatgaacatagaggat
ggaaagaactacagtcttgtcatgtatgctaaatcattagaaaatacagagttaacagtt
tcactaacaagctctgatgggttgcaaaatctgtcttctgctaccatacaagttgctggt
acatcaaattggacaaaacttgagcagaagttggttgctaaaggaacaaacagaacctca
aggcttcaaataacaactaacaagaaaggtgtcatatggttggatcaaatatcactcatg
ccttcagacacgtataagggtcatggtttccggaaagaacttgtatcaatgcttttggat
ttaaaaccacaattcatgaggtttcctggaggctgctttgttgaaggccagtggttaaga
aatgcattcaggtggcgtgagtctgttggtccgtgggaggagaggcctggacactttggt
gatgtctggggttattggactgatgatggccttggatattatgagtttcttcagctttct
gaggatctgggtgctgccccaatctgggtgttcaacaatggtttcagccacaatgaggag
attaataccacggctattgctccatttgtaaaggatatactggacagcctagaatttgca
aggggaagtaccaactcaacatggggctctcttagagttgcaatggggcatcctgaacca
tttccagtcaaatatgttacaattggaaacgaagactgtacaaaaaaattttaccatggt
aattacctcaagttccatcgtgctataagagaggcttatccagacattcaaatcatctca
aactgtgatggttcatctaaaccacttgaccatcctgctgacatatatgacttccatgtc
tacggggattctaatactttgttttctatgaggaacaaatttgacagcacgcctcggaat
gggacaaaggcctttgtcagtgagtatgctgtttcaagtaatggtgtaggtagaggaact
cttcttgcctcactggctgaggctgctttcctcactggactggagaagaatagtgatgtt
gttcagatggccagctatgcaccgctcttcatgaatgataatgatctctcgtggaaccca
gctgctgtcgtcttcaactcatggaaacagtatggaagtcctagttactggatgcagaca
attttccgcgaatcgagtggtgctgtgctgcatccagtgacaatcaactccatgtattct
aattcattagcagcttctgcaataacctggaaagccagtaacagtagcttcttgagagtg
aagattgtaaacattgggtccaaccctgtgaacctcatagtatccacaactggtcttgaa
gctttggtcaatatgcggaaatcaacaatcactattctcacatccaaaaatctgtcagac
gaaaattcattcagtaaacccactaatgtcgtgccggttacaagagaactacccaatgct
ggagaagagatgtttgctttccttggtccttactcatttacttcatttgatcttgctctc
ggccagcagaaacatgtttcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332668
Entry
4332668           CDS       T01015                                 
Name
(RefSeq) alpha-L-arabinofuranosidase 1 isoform X1
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4332668
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     4332668
SSDB
Motif
Pfam: Alpha-L-AF_C CBM_4_9
Other DBs
NCBI-GeneID: 4332668
NCBI-ProteinID: XP_015632208
UniProt: Q10M79
LinkDB
Position
3:complement(11546334..11549570)
AA seq 675 aa
MGVRRGRLDSSLFHMLVLVCALSQVLFVGLVTGQTAQLSVDASSQNGRTIPDKMFGIFFE
ELNHAGAGGLWAELVSNRGFEAGGINTPSNIDPWLIIGDESNIIVETDRSSCFASNPIAL
RMEVLCGATGTNACPSGGVGIYNPGYWGMNIEKTKVYKVSMYIRSSDSVDLAVSLTSSDG
LQNLATHTITAEKGDFAGWTKVEFDLQSSERNTSSRLQLTTTKNGIIWFDQVSVMPSDTY
MGHGFRKDLATMLANLKPRFLKFPGGNYVMGNYLLNAFRWSETIGPWEERPGHFNDVWNY
WTDDGLGFFEFLQLAEDLDACPVWVINDGASLNEQIPSATIAAFVKDVVDGIEFARGDPK
TTWGSVRAAMGHPEPFPLYYISVGNQECSKPYYKEKYVKFYSAIKASYPDIKIISSCDIS
SISAVNPADLYDVHVYTSSGDMFSKTRMFDSTPRSGPKAFVSEYAVTGNDAGRGTLVAAL
AEAAFLIGLERNSDVVEMASCAPLFINDNDRGFSPDAIVFNSWQHYGCPNYWMLHFFKDS
SGATLHPLTIQVSNYDQLAASALTWQNSNDGNTYLKIKVVNFGNKAVNLNIAVAGLENGI
QEFGSIKTVLTSGWLRDENSFQQPDKVVPAASPITNAGEKMGVIVDPYSLTSFDLLLDTN
TDKYPLLESSFHSSM
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgggcgttcggagaggtcgtttggattcctcattgttccacatgctggttctcgtttgc
gccctgtctcaggtgctctttgttgggctggttaccggtcaaactgcacagttgagtgtg
gatgcttcatcccagaatggtcggacgatccctgacaaaatgttcggcatcttttttgag
gagctcaaccatgccggggctggtggactgtgggcagagcttgtaagcaacagaggtttc
gaagctggtggcattaatactccttcaaatattgacccatggttgataattggagatgag
tcaaatataattgtggaaacagataggtcatcatgttttgccagtaacccaattgcactt
cgcatggaagtactctgtggagctaccggaactaatgcttgcccttcaggaggtgttggt
atctataatcctggttactggggcatgaacattgaaaaaacaaaggtctacaaagttagc
atgtacattaggtcatcagattcagtggatttggcagtttctttgacaagttcagatggt
cttcaaaatctagccactcataccatcacggctgagaagggagattttgcaggatggaca
aaggttgagtttgatttgcagtcaagtgaaagaaatactagttcaaggctgcaacttaca
accaccaaaaatggcataatttggtttgaccaagtatcagttatgccatcagacacttat
atggggcatggttttcgtaaagatcttgccactatgctggcaaatctgaagcctcggttt
ttaaaatttccaggtggaaactatgtcatgggaaattatttactgaacgcattccggtgg
agtgaaaccattggaccttgggaagagagacctggtcactttaatgatgtttggaattat
tggactgatgatggactaggcttttttgagttccttcaattggcagaagaccttgatgcc
tgcccagtttgggtgatcaatgatggggccagccttaacgaacaaattccatctgcaaca
atagctgcttttgtaaaggacgttgttgatggcattgagtttgctaggggagaccctaag
actacatggggttcagttcgtgcagcaatgggacatccagagccctttccgctttattat
atttcagtagggaatcaagaatgctcaaagccgtactacaaagagaaatacgtgaagttc
tattctgcaataaaagcgtcttacccggacatcaaaattatatcaagctgtgacatatct
tccatttcagcagtcaaccctgctgatctatatgatgtccatgtttatacatcatctggt
gatatgttttccaaaacaagaatgtttgatagcacaccccgcagtggacccaaggcattt
gttagtgaatatgcggtgactggaaatgatgctggccgaggaacattagtagctgctcta
gcagaagctgcatttctcattggattagaaagaaacagtgatgtggtcgagatggcaagt
tgtgctccactcttcataaatgacaacgatcgcgggtttagtccagatgccatagtcttc
aactcatggcagcactatggatgtccaaactactggatgctacacttcttcaaggactca
agtggtgcaacacttcatcccttgacaattcaggtgtcaaactatgatcaattggccgca
tctgctctcacttggcagaattctaacgatggaaacacttacttgaaaataaaggttgtc
aattttggtaacaaagctgtgaatcttaatatagctgtagctggactagagaatggcatt
caggaattcgggtccataaagacggtgcttacatctggttggctgcgggatgagaactct
ttccaacagcctgacaaggtggtgccggcggcaagccccataaccaacgcgggcgagaag
atgggtgtcattgtggatccatactccctcacctcgtttgatctcctcctggacaccaac
acagacaaatacccactattggagtcgagctttcattcaagcatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349683
Entry
4349683           CDS       T01015                                 
Name
(RefSeq) alpha-L-arabinofuranosidase 1 isoform X1
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4349683
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     4349683
SSDB
Motif
Pfam: Alpha-L-AF_C
Other DBs
NCBI-GeneID: 4349683
NCBI-ProteinID: XP_015617519
LinkDB
Position
11:1453571..1460005
AA seq 687 aa
MASRESFMSTIFFFLLLFSLGCKCIASELHLHATQTAVLKVDASPQLARQIPDTLFGIFF
EEINHAGAGGIWAELVSNRGFEAGGPHTPSNIDPWSIIGDDSSIFVATDRTSCFSRNTVA
LRMEVLCDNCPAGGVGIYNPGFWGMNIEDGKIYNLVMYVKSPETVELTVSLTSSDGSQNL
ASTTIPLVPFLSILGQENKDVCPFPLVLKGLYCCRVSGASNWTKLEQKLVAQGTNRTSRL
QITTNKKGVVWFDQVSLMPADTYKGHGFRTELISMMLDLKPRFLRFPGGCFVEGEWLRNA
FRWRESIGPWEERPGHFGDVWHYWTDDGLGYYEFLQLSEDLGAAPIWVFNNGISHNDEVD
TAAIAPFVKDVLDSLEFARGNADSTWGSVRAAMGHPEPFPVKYVAIGNEDCGKKFYRGNY
LKFYNAIREAYPDIQMISNCDASSSPLDHPADLYDFHVYTDSKTLFSMKNTFDRSSRNGP
KAFVSEYAVWRSDAGRGSLLASLAEAAFLTGLEKNSDVVQMASYAPLFVNNNDQTWNPDA
IVFNSWQQYGTPSYWMQTLFGESSGAMFHPVTITSSYSGSLAASAITWQDSENSFLRVKI
INFGSDPVSLTISATGLQARVNALGSTATVLTSSNVMDENSFSNPNKVVPVKSQLSNAAE
QMQVTLAPHSFSSFDLALAQSKLVAEM
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggcttccagagaatccttcatgagtaccattttcttcttcttgcttctgttctccctc
ggctgcaagtgtatagcttcagagttacacttacatgcgacccagactgcggtcctcaag
gttgatgcctcaccgcaacttgctcgacagatccctgacacactatttggaatatttttt
gaggaaatcaaccatgcaggggctggtggaatatgggctgaacttgttagtaacagaggt
tttgaagctggaggccctcataccccatcaaacattgatccatggtccataattggtgat
gactcttccatatttgtggcgactgatcgaacgtcatgttttagtcggaatactgttgct
ctaaggatggaggttctctgtgataattgcccagctggtggtgttggcatttataaccca
gggttctggggcatgaacatagaagatggaaagatctacaatttagtgatgtatgttaaa
tcaccagaaactgtggagttgacagtttccttaacaagttctgatgggtcgcaaaatttg
gcttcaactaccataccgttagtgccttttctctcaatactgggacaggagaacaaggat
gtttgcccattcccattagttttgaaaggattatattgttgcagggtttctggtgcatcg
aattggacaaaactggagcagaagttggttgctcaaggaacaaatagaacctcaaggctt
caaataacaactaacaagaagggagttgtatggtttgatcaagtatcgctcatgcctgca
gacacttacaagggacatggttttcgcacagaacttatatctatgatgttggacttaaaa
ccacgattcttgagattccctggaggttgctttgtggagggggaatggttaaggaacgca
ttcaggtggagggaatctattggtccatgggaagagaggcctggacactttggggatgtt
tggcattactggactgatgatggccttggatattatgaatttctccagctttctgaggat
ctgggtgctgccccaatctgggtgttcaacaatggaatcagccataatgatgaagttgat
actgctgcgattgctccttttgtaaaagacgtattggacagtctagaatttgcaaggggg
aatgcagattcaacatggggttctgttagagctgcaatggggcaccccgaaccattccct
gtcaaatacgtcgcaattggaaatgaagattgtgggaaaaaattttaccgcggtaattac
ctcaagttttataatgctataagggaggcctatccagacattcaaatgatttcaaattgt
gatgcttcatcaagtccacttgaccatcctgctgatttatatgatttccatgtctatact
gattctaagactttgttttcaatgaagaatacatttgatagatcatctcgtaatgggccc
aaggcttttgtcagtgaatatgctgtttggagaagtgatgcaggtagaggaagtctactt
gcttcattggcagaggcagctttccttactggactggagaagaatagtgatgttgttcag
atggcaagttatgcaccactcttcgtgaacaacaatgatcaaacgtggaacccagacgcc
attgtatttaactcctggcaacaatatggaactcctagttactggatgcagactcttttc
ggtgaatctagcggtgctatgtttcatccagttacaatcacttccagctactctggttct
ctggcagcatctgcaattacttggcaggattctgaaaatagcttcttaagagtaaagatt
ataaactttgggtctgatccagtgagcctcacgatctctgcaactgggcttcaggcccgt
gttaatgcactgggatcaactgccactgttctcacatccagtaatgtgatggatgagaac
tcttttagtaacccgaataaggttgttcctgtcaaaagccagctttccaatgcagcagag
cagatgcaagtcacgcttgctcctcactctttctcctcattcgatcttgcgcttgcccag
tccaaactcgtggcagagatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349687
Entry
4349687           CDS       T01015                                 
Name
(RefSeq) alpha-L-arabinofuranosidase 1
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4349687
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     4349687
SSDB
Motif
Pfam: Alpha-L-AF_C
Other DBs
NCBI-GeneID: 4349687
NCBI-ProteinID: XP_015617578
UniProt: Q2RAZ2 Q0IUV6
LinkDB
Position
11:1484063..1491791
AA seq 657 aa
MGFEETYFSAFCYLLLFSVSWKCQAAELDMAQTAVLEVDASWNLSRKIPDTLFGLFFEEI
NHAGAGGIWAELVSNRGFEAGGPHTPSNIDPWSIIGDESSIYVTTDCSSCFRQNIVALRM
EILCDNCPAGGVGIYNPGFWGMNIEEGKAYNLVMYIRSLESVELTASLTCSDGMQNLASV
SIQGIDLSNWTKIELQLLAEGTCRTSRLELTSMKKGIIWFDQVSLMPSDTYKGHGFRKEL
LYMLLELKPQFLRFPGGCFVEGDWLRNAFRWRETIGPWEQRPGHFGDVWNYWTDDGLGYY
EFLQLSEDLGAAPIWVFNVGISHHDEVDTTIIEPFVKDVLDSLEFARGRAESTWGSVRAA
MGHPERFPLKYVAIGNEDCDKGFYRGNYLKFYDAIRKAYPDIQMISNCDGSSRPLDHPAD
LYDFHVYTSAANLFIMKNKFDRTSRIGSKVFVSEYAVNEQRDAGKGSLLASLAEAAFLTG
LEKNSDLVQMASYAPLFVNDNDRTWNPDAIVFNSWQQYGTPSYWMQTYFRESSGSVIHPI
TIGSSYSDSLAASAITWKDTHDIFLRIKIVNFGPNAVNLAISSRGLQAGVNTAKSTVTVL
TSGNLLDENSFAEPNKVVPVKSELPDASEEMEAALSPYSFTSFDLALDQYSKLVAEM
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgggtttcgaagaaacatatttttctgccttctgttacttgcttcttttctctgtcagc
tggaaatgccaagctgcagaactggacatggctcagacagcagtactcgaagttgatgct
tcatggaacctttctcgaaagatccctgacacgctatttggattgtttttcgaggaaatt
aaccatgccggagctggtgggatatgggcggagcttgtcagtaacagagggtttgaagct
ggagggccccacaccccttcaaatattgacccatggtctatcattggagatgaatcctct
atatacgtcacgactgattgctcatcttgtttccgccaaaatattgttgctctaaggatg
gagattctctgtgataattgtccagccggcggtgtcggcatttacaacccaggattctgg
ggcatgaatatagaagaaggaaaagcctataatctagtcatgtatatcagatcattagaa
tcagtcgaattgacagcttcgctcacatgctcagatggaatgcaaaatctggcatcagtt
tctatacaaggtattgatctgtcaaattggacaaagatagagttgcaattactagctgaa
ggaacatgcagaacttcaagacttgaattaacaagtatgaaaaagggaataatttggttt
gatcaagtgtcactcatgccttcagacacatacaagggccatggctttcgcaaggaacta
ctatacatgcttttggaattaaaaccacagttcctacgctttcctggggggtgctttgtt
gaaggcgattggttaagaaatgctttcaggtggagggaaactattggtccctgggaacag
agacctgggcactttggagatgtttggaattattggaccgatgatggcctaggatattac
gagtttctccagctttctgaagacctgggtgctgcccctatttgggtgttcaatgttggg
atcagccaccatgatgaagtcgataccaccataattgaaccttttgttaaggatgtattg
gatagtcttgaatttgcaagggggagagcagaatcgacatggggttctgttagagctgca
atggggcatccagaacggttcccactgaagtatgttgctattggaaatgaagattgtgac
aagggattttaccgaggaaattacctcaagttttatgatgctatacgcaaggcctatccg
gatattcaaatgatttcaaactgtgatggatcatctaggccacttgatcatcctgctgat
ttatacgatttccatgtctataccagtgctgctaatctttttatcatgaagaataagttt
gataggacatcacgcattgggtctaaggtatttgtcagtgagtatgctgtcaatgaacaa
agggatgctggtaaaggaagccttcttgcttcactggctgaggctgctttccttactggg
ttagagaaaaatagtgatcttgttcagatggcaagctatgcaccgctcttcgtaaatgac
aatgaccgcacctggaacccagatgcaattgtattcaattcctggcaacagtatggcact
cctagttattggatgcaaacatatttccgtgaatcaagtggttctgtgattcatccaatt
acgatcggttccagctactccgattcactggctgcatctgcaatcacctggaaagacaca
catgatatctttctgagaataaagatagtaaactttgggccaaatgctgttaacctcgca
atatcttcaagaggacttcaagctggcgtcaatacggcaaaatcaactgtgactgttctc
acatccggcaatttgctggatgaaaattcatttgctgaaccaaacaaagtcgtaccggtt
aaaagcgagctgccagatgcttcagaagagatggaagcagcgctctctccttattcattc
acttcatttgacctcgctctagatcagtacagcaagctcgtggcagagatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351401
Entry
4351401           CDS       T01015                                 
Name
(RefSeq) alpha-L-arabinofuranosidase 1
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4351401
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     4351401
SSDB
Motif
Pfam: Alpha-L-AF_C CBM_4_9
Other DBs
NCBI-GeneID: 4351401
NCBI-ProteinID: XP_015620357
UniProt: Q2QY88 Q0IQD4
LinkDB
Position
12:1359591..1366381
AA seq 660 aa
MGSREPFLSAIFFFFFLLLFCLGCKCIASELHLHTTQTAVLKVDASLQHARQIPDTLFGI
FFEEINHAGAGGIWAELVSNRGFEAGGPHTPSNIDPWSIIGDDSSIFVATDRTSCFSRNT
VALRMEVLCDNCPAGGVGIYNPGFWGMNIEDGKTYNLVMYVKSPETVELTVSLTSSDGSQ
NLASSTIPVSGASNWTKLEQKLVAKGTNRTSRLQITTTKKGVVWFDQVSLMSADTYKGHG
FRTELISMMLDLKPRFLRFPGGCFVEGEWLRNAFRWRESIGPWEERPGHFGDVWHYWTDD
GLGYYEFLQLSEDLGAAPIWVFNNGISHNDEVDTAAIAPFVKDVLDSLEFARGSADSTWG
SVRAAMGHPEPFPVKYVAIGNEDCGKKFYRGNYLKFYNAIREAYPDIQMISNCDASSRPL
DHPADLYDFHVYTDSKTLFSMKSAFDRSSRNGPKAFVSEYAVWRSDAGRGSLLASLAEAA
FLTGLEKNSDVVQMASYAPLFVNNNDQTWNPDAIVFNSWQQYGTPSYWMQTLFRESSGAM
FHPITITSSYSGSLAASAITWQDSENSFLRVKIINFGSDPVSLTISATGLQARVNALGST
ATVITSSNVMDENSFSNPNKVVPVKSQLSNAAEQMQVTLAPHSFSSFDLALAQSKLVAEM
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgggttccagagaacccttcctgagtgccatcttcttcttcttcttcttgcttttgttc
tgcctcggctgcaagtgtatagcttcagagttacacttacacacgacccagactgcggtc
ctcaaggttgatgcctcactgcaacatgctcgacagatccccgacacgctatttggaata
ttttttgaggaaatcaaccatgcaggagctggtggaatatgggctgaacttgttagtaac
agaggttttgaagctggaggccctcataccccatcaaacattgatccatggtccataatt
ggagatgactcttccatatttgtggcgactgatcgaacgtcatgtttcagtcggaatact
gttgctctaaggatggaggttctctgtgacaattgcccagctggtggtgttggcatttat
aacccaggattctggggcatgaacatagaagatggaaagacctacaatttagtgatgtat
gttaaatcaccagaaactgtggagttgacagtttccttgacaagttctgatgggtcgcaa
aatctggcttcaagtaccataccggtttctggtgcgtcgaattggacaaaactggagcag
aagttggttgctaaaggaacaaatagaacctcaaggcttcaaataacaactaccaagaag
ggagttgtatggtttgatcaagtctctctcatgtctgcagacacttacaagggacatggt
tttcgcacagaactaatatctatgatgttggacttaaaaccacgattcttgagattccct
ggaggttgcttcgtggagggtgaatggttaagaaacgcattcaggtggagggaatctatt
ggtccatgggaagagaggcctggacactttggggatgtttggcattactggactgatgat
ggccttggatattatgagtttctccagctttctgaggacctgggcgctgccccaatctgg
gtgtttaacaatggaatcagccataatgatgaagttgatactgctgcaattgctcctttt
gtaaaagacgtattggacagtctagaatttgcaagggggagtgcagattcgacatggggt
tctgttagagctgcaatggggcaccctgaaccattccctgtcaaatacgttgcaattgga
aatgaagattgtgggaaaaaattttaccgcggtaattacctcaagttttataatgctata
agggaggcctatccggacattcaaatgatttcaaattgtgatgcttcatcaagaccactt
gaccatcctgctgatttatatgacttccatgtctatactgattctaagactttgttttcg
atgaagagtgcatttgatagatcatctcgtaatgggcccaaggcttttgtcagtgaatat
gctgtttggagaagtgatgcaggtagaggaagtctacttgcttcattggcagaagctgct
ttccttactggactggagaagaatagtgatgttgttcagatggcaagttatgcaccactg
ttcgtgaacaacaatgatcaaacgtggaacccagacgccattgtatttaactcctggcaa
caatacggaactcctagttactggatgcagactcttttccgtgaatctagcggtgctatg
tttcatccaattacaatcacttccagctactctggttctctggcagcatctgcaattact
tggcaggattctgaaaatagcttcttaagagtaaagattataaactttgggtctgatcca
gtgagcctcacgatctctgcaactgggcttcaggcccgtgttaacgcactgggatcaact
gccactgttatcacatccagcaatgtgatggatgagaactcttttagtaacccgaataag
gttgttcctgtcaaaagccagctttccaatgcagcagagcagatgcaagtcacgcttgct
cctcactctttctcctcattcgatcttgcgcttgcccagtccaaactcgtggcagagatg
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351402
Entry
4351402           CDS       T01015                                 
Name
(RefSeq) alpha-L-arabinofuranosidase 1 isoform X1
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4351402
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     4351402
SSDB
Motif
Pfam: Alpha-L-AF_C
Other DBs
NCBI-GeneID: 4351402
NCBI-ProteinID: XP_015618364
LinkDB
Position
12:1367594..1376245
AA seq 513 aa
MNVEEGKAYNLVMHIRSLESVELTASLTCSNGSQNLASNSVRETNLSTWTKIELQLLAQG
TCRTSRLELTTRKRGVIWLDQVSLMPSETYKGHGFRKELMYMLLDLKPRFLRFPGGCFVE
GNWLKNAFRWKETIGPWEERPGHYGDVWHYWTDDGLGYYELLELAEDLGANPVWVLNIGM
SHHDAVNGTMLAPFIKDATDSLEFAKGSDKSTWGSVRATMGHPEPFPLKYVALGNEDCAP
FKLIYRENYPKFYNAIKEAYPDIQIISNCDGSSGPLDHPADLYDYHIYENASTVFFKKNE
FDRTSRNGPKVFVSEYAVNGEDAGNGSLLASLAEAAFLIGLEKNSDVVQMACYAPLFVND
NDRVWNPDAIVFNSWQQYGTPSYWMQTYFRESSGAMIHPIMISSSYSDLLAASAITWQDA
ENTFLRVKIVNFGPNAVNLTISSSGLQAGVDTAKSTVTVLTSSNLLDENSFSEPNKVVPV
ASELPNAAEQMYDYLLLQFGPGFKTSGHHAGLI
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaatgtagaagaaggaaaggcatataatctggtcatgcatatcagatcattagaatcg
gtggagttgacagcttcactcacatgctcaaatggatcgcaaaatcttgcatcaaattct
gttcgagaaactaatttgtcaacttggacaaagatagagctacagttactagctcaaggg
acatgcagaacttcaagacttgaactaacaactaggaaaaggggagtaatatggcttgat
caggtgtcacttatgccttcagaaacatacaagggccatggttttcgcaaggaactcatg
tacatgcttttggacttaaaaccacggtttctacggtttcctgggggttgctttgtcgaa
ggcaattggttaaaaaatgcattcaggtggaaggaaactattggtccatgggaagagaga
cctggacactatggagatgtctggcactactggacggatgatggccttgggtattatgag
ttactcgagcttgctgaagacttgggtgctaaccctgtatgggtgctcaacattgggatg
agtcaccatgatgcagttaatggaactatgctcgcaccttttataaaggatgcaactgac
agtcttgagtttgcaaaggggagtgacaaatcaacatggggctctgttagagccacgatg
gggcaccctgaaccattcccactgaagtatgttgcactagggaatgaagattgtgctcca
ttcaagctgatataccgagaaaattatcccaagttctacaacgccataaaagaggcttat
cctgacatccaaataatttcaaactgtgatggctcgtctgggccacttgatcatcctgcc
gatctctatgactaccatatatatgaaaatgcatccactgtgtttttcaagaagaatgaa
tttgataggacatcacgtaatggtccaaaggtatttgtaagtgagtatgctgttaatggt
gaggatgctggcaatggaagccttcttgcatcattggcagaagctgctttcctaattggt
ttagagaaaaatagtgatgtcgttcagatggcatgttatgcaccactcttcgtgaatgac
aacgatcgcgtctggaacccagatgcgattgtcttcaactcctggcaacagtatggaact
cctagttattggatgcagacatatttccgtgaatcaagcggtgctatgattcatccaatt
atgatcagttccagctactctgatttattggctgcctctgcaatcacctggcaagacgct
gagaatacctttctgagagtgaagatagtaaacttcgggccaaatgctgtgaacctcaca
atatcttcaagtggacttcaagctggtgtagatacggcaaaatcaactgtgactgttctc
acatccagcaacttgctggatgaaaattcatttagtgaaccaaacaaggtcgtgccagtt
gccagcgagttgccgaatgcagcagaacagatgtatgattaccttcttttgcaatttgga
ccgggttttaagacttcgggccaccacgctggcttgatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268316
Entry
9268316           CDS       T01015                                 
Name
(RefSeq) alpha-L-arabinofuranosidase 1
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    9268316
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     9268316
SSDB
Motif
Pfam: Alpha-L-AF_C
Other DBs
NCBI-GeneID: 9268316
NCBI-ProteinID: XP_015615415
LinkDB
Position
11:1461093..1467658
AA seq 552 aa
MDGFEAGANTSNIDPWSIIGDESSVHVTTDRSSCFSQNPVAVRIEVVCDDCPAGGVGIYN
PGFWGMNVEERKTYNLVMHIRSLESVELTASLTCSNGSQNLASNFVRETDLLNWTKIELQ
LLAHGTCRTSRLELTTRRRGVIWLDQVSLMPSETYKGHGFRQELMYMLLDLKPRFLRFPG
GCFVEGNWLKNAFRWKETIGPWEERPGHYGDVWHYWTDDGLGYYDFLQLAEDLGAAPFLS
CDLGMSHSDVVNGTMLTPFVKDAIDSLEFARGSKESTWGSVRAAMGHPEPFPLKYVALGN
EDCEIFKPTYQENYPKFYNAIREAYPDIQIISNCDGSSRPLDHPADLYDFHVFVSEYAVN
NDKGGDAGNGSLLASLAEAAFLTGLEKNSDVIQMASYAPLFVNENDRTWNPDAIVFNSWQ
QYGTPSYWMQTYFRESSGSVIHPVTISSSYFDLLAASAITWQDNEDIFLRVKIVNFGPSA
VNLTISSSGLQAGVNAAKSTVTVLTSSNLLDENSFSEPNKVVPVTRELPNAGQEMQFLLL
PFSLTSFDLAMF
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggatggttttgaagctggagccaacacatcaaacattgacccatggtccatcattgga
gatgaatcctctgtgcacgtcacaactgatcgctcatcctgtttcagtcaaaatccggtt
gctgtaaggatagaggttgtctgtgacgattgtccagctggtggtgttggaatatacaat
ccaggattctggggcatgaatgtagaagaaaggaagacatataatctagtcatgcatatc
agatcattagaatcggtggagttgacggcttcactcacatgctcaaatggatcgcaaaat
ctggcatcaaattttgttcgagaaactgatttgttaaattggacaaagatagagctgcag
ttactagctcatgggacatgcagaacttcaagacttgaactgacaactaggagaagggga
gtgatatggcttgatcaggtgtcactcatgccttcagaaacatacaagggccatggtttt
cgccaggaactcatgtacatgcttttggacttaaaaccacggtttctacggtttcctggg
ggttgctttgttgaaggcaattggttaaaaaatgcgttcaggtggaaggaaactattggt
ccatgggaagagagacctgggcactatggagatgtttggcactactggaccgatgatggc
cttgggtattatgactttctccagcttgctgaagacttgggtgctgctccatttttatct
tgtgatttagggatgagtcacagtgatgtagttaatggaactatgcttacaccttttgta
aaggatgcaatagacagtcttgagtttgcaagagggagtaaagaatcaacatggggctct
gttagagccgcgatgggacaccctgaaccattcccactgaagtatgttgcactcgggaat
gaagattgtgaaatattcaagccgacataccaagaaaattaccccaagttctacaatgct
atacgagaggcttatcctgacattcaaataatttcgaactgtgatggctcgtctaggcca
cttgatcatcctgctgatctgtatgacttccatgtatttgtaagcgagtatgctgttaat
aatgacaaagggggtgatgctggcaatggaagcctccttgcatcgttggcagaagctgct
ttcctcactggtttagagaaaaacagcgatgtcattcagatggcaagctatgcaccactc
ttcgtgaatgaaaatgatcgcacctggaacccagatgcaattgtcttcaactcctggcaa
cagtatggaactcctagttattggatgcaaacatatttccgtgaatcaagtggttctgtg
attcatccagtcactatcagctccagctactttgatttactggcagcatctgcaatcacc
tggcaggacaatgaggatatctttctgagggtaaagatagtaaactttgggccaagtgct
gtgaaccttacaatatcttcaagtggacttcaagctggtgtaaatgcggcaaaatcaact
gtgactgttctcacatccagcaacttactggatgagaattcatttagtgaaccaaacaag
gttgtgccagttacaagggagttacccaatgctgggcaagagatgcagttcttactcctt
ccattctcattgacctcatttgatctggctatgttttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268769
Entry
9268769           CDS       T01015                                 
Name
(RefSeq) alpha-L-arabinofuranosidase 1
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    9268769
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     9268769
SSDB
Motif
Pfam: Alpha-L-AF_C
Other DBs
NCBI-GeneID: 9268769
NCBI-ProteinID: XP_015646746
UniProt: B9FUY9
LinkDB
Position
7:29182932..29188587
AA seq 664 aa
MAVQRTDAASWLRELVLVYAMCWTVSLGFVAGQTGQLNVDASPQNARKIPDKMFGIFFEE
INHAGAGGLWAELVSNRGFEAGGPNTPSNIDPWLIIGNESSIIVGTDRTSCFEKNPVALR
MEVLCDSKGTNNCPSGGVGVYNPGYWGMNIERRRVYKVGLHIRSSDAVSLTVSLTSSDGL
QKLASHTITASKKQFAKWTKIEFHLKSSQTNTNSRLQLTTSKSGVIWLDQVSVMPSDTYM
GHGFRKDLASMLANLKPQFLKFPGGNYAMGNYLRNAFRWSETVGPWEERPGHFNDAWGYW
TDDGLGFFEFLQLAEDLGASPVWVVNDGASQNEEVSTATIASLVKDVVDGIEFARGGPKT
TWGSVRAAMGHPQPFNLDYVSIGNQECWMLYYRGNYQKFYSAIKAAYPDINVVSSCDKST
ISPSNPADLYDVHVYTSSSDMFSRTSMFDNTTRSGPKAIVSEYAVTGKDAGKGTLVEALA
EAAFLVGLERNSDVVEMASCAPLFVNDNDRRWSPDAIVFNSWQNYGCPNYWMLHFFKDSC
GATFHPSNIQISSYNQLVASAITWQNSKDKSTYLKIKLVNFGNQAVNLSISVSGLDEGIK
SSGSKKTVLTSSGPLDENSFQQPQKVAPVSSPVDNANEQMGVLVDPYSLTSFDLLLQPSK
HSTI
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggcagtgcagagaacagatgctgcctcttggctccgtgagctggttcttgtttacgcc
atgtgctggacagtctcactgggttttgttgcgggtcaaaccgggcagttgaatgtcgat
gcctcgccgcagaatgcaaggaagatccctgataagatgttcggtatatttttcgaggag
atcaaccatgctggggctggtgggttgtgggcagagcttgtaagtaacagaggttttgag
gctggtggacctaatacaccttcaaacattgacccatggctgataattgggaacgaatca
agtatcattgttgggactgataggacatcctgttttgagaaaaatccggtggcacttcgg
atggaagttctttgtgattctaaaggaaccaataactgcccttctggaggtgtaggagtc
tacaatcctggttattggggcatgaatattgaaagaagaagggtttataaggtgggcctg
cacattagatcttcagatgcagtatccttaactgtttccttgacaagctccgatggtctg
cagaaactggcctctcacaccataacggctagcaagaaacagtttgctaaatggacaaag
atagagtttcatctgaaatctagccaaaccaatactaattcaaggctccagcttacaacc
agcaaaagtggggtgatttggctcgaccaggtgtcagttatgccatcggatacctacatg
ggacacggttttaggaaagatctcgcttctatgttggccaatttaaaacctcaatttctt
aagtttccaggtggtaactatgccatgggaaattatctgcgaaatgcatttcgatggagt
gaaactgtgggtccatgggaggaaagacccggtcacttcaatgatgcctggggatactgg
actgatgatggacttggattctttgagttccttcagctagctgaagacctcggtgcttcg
ccagtatgggtggtcaatgatggagcaagccaaaatgaagaggtatctactgcaacaatt
gcatcattagtgaaggacgtggttgatggcatcgagtttgccaggggagggcccaagact
acatggggttcagttcgtgcagcgatgggtcatccacaaccctttaaccttgactatgtt
tcaatagggaatcaagaatgctggatgctctattacagaggcaattaccaaaaattctat
tccgcgattaaagctgcctatccagacatcaacgtcgtgtcaagttgtgataaatccact
atttctccgtccaaccctgccgatctatatgatgttcatgtttatacctcatctagtgat
atgttttccagaactagtatgtttgacaatacgacgcgcagtggaccgaaggcaattgta
agtgagtacgctgtgactggaaaggatgctggcaaaggaacactggtagaagcactagca
gaggcagcatttctcgttggattagaaagaaacagcgacgtggtagagatggcaagctgt
gcaccgctctttgtaaatgacaatgatcgcagatggagtccagacgcaattgtgttcaac
tcatggcagaactatggatgcccaaactactggatgctacatttcttcaaagattcatgc
ggcgcaacgttccacccatcaaacattcagatttccagctacaaccagctggttgcatct
gccatcacttggcagaatagcaaagacaagagcacttacctgaaaataaagctagtgaac
tttggcaaccaagctgtgaatctcagcatatctgtgtctgggctggatgagggcatcaag
agctcagggtcgaagaagaccgtgcttacttccagcgggccgcttgatgagaactcattc
cagcagccacaaaaggtggcgccagtgtcgagcccggtggacaacgcgaatgagcagatg
ggcgtgttggtggatccatactccctcacgtcgttcgacctgctgctgcaaccgagcaag
cactcgaccatatga

DBGET integrated database retrieval system