KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277028
Entry
107277028         CDS       T01015                                 
Name
(RefSeq) SNF2 domain-containing protein CLASSY 3-like
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107277028
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    107277028
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     107277028
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     107277028
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII
Other DBs
NCBI-GeneID: 107277028
NCBI-ProteinID: XP_015623860
LinkDB
Position
2:26232001..26239229
AA seq 1044 aa
MEMEVEVEVRSDDNDHGNGGIRGEGGGTDDVAEIEEEELGTDEDETSDDSDENFSDEEGD
EEELEEEEEEEEEEEDDDDDDEEEEEPGDAPDQPGEAGEESPPRSRIMAMPLMGKRMFEG
FSFLQQVDTSTGRDIRARTRSNFKRKKLLDKKLLKRGTFAKPYCIDVSSSGSEEDVPQPE
QSAYGGDCADDDGGSDGNEEHRAVKRRKLNRRQSAHSDSEEDTTFVCDVKEGSGSRRVQE
GAPRRQVKKEGSNKKKDGSTPQCVRNNGPKVGRQTNGLNGQGGVSFKRNVKIAQRRKRRQ
ATADQEKYGHLLDPMFNEIESNQYEPVPEEQIDRRLPLVFAFGDDDKLEEKSKHDKLQDE
DELWKEFDFALESINVCSHNCEEGEKEDEQEIPADKAASCIQGKHELIIDEQIGLRCKHC
NFVDLEIRFVLPSMVKSCTERDMRKDHELDLFFDDILTSAGYEGPRDFGGKKTGLVWDLV
PGVREDMFPHQQEGFEFMWRKLAGGTSIEQLRNNANTIEGGCVISHAPGTGKTRLAITFV
QSYFAFFPECCPVIIAPRGMLATWEQEFRKWKVKVPFHVLNSKEINWKEDRTIKQLAIMD
ENLAQSLARNKLDHKFRRKLKLASWRKGSSIIGVSYTLFRKLANQSSMDGNMVRNLLLEM
PDLLVLDEGHTPRNKKSLIWKVLEEVRTKKRIILSGTPFQNSFLELSNVLYLIRPKFARH
FASKSFKKIGLEDYWTSLTLNNITEKKIDEIRQILDPIVHIHNGDILQKSLPGLRESVVI
LNPLPHQKEIITAMENTVTMGTLDAEYKISLASIHPFLVTCAKLSEKETSSVDVSLLKSL
RPNPCVGVKTKFVLEIVRLCEAMKERVLVFSQYLEPLSLIMDQLSKMFNWIEGEEILLMS
GNVLVQNREALMEAFNDMKSNAKVMLASTKACCEGITLIGASRVVLLDVVWNPSVGRQAI
GRAYRIGQEKIVYTYNLITEGTKEKDKYDRQAKKDHMSKLLFSKEPHAAGFNLSQEVIFN
DKILEAMTSHRELKDMFVKILHSH
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggagatggaggtggaggtggaggttcgttcagatgacaacgatcatggcaatggtgga
atcaggggagaaggtggaggtacggacgatgttgcggagatagaggaggaggaattgggt
acggatgaagatgaaaccagtgatgatagcgatgagaacttcagcgatgaggaaggggat
gaagaggaattggaggaggaggaggaggaggaggaggaagaagaagatgatgatgatgat
gacgaggaggaggaggaaccgggtgatgcacctgatcaaccgggtgaggccggtgaggaa
tctcctccccgatcaagaatcatggcaatgccgctgatgggaaagaggatgtttgaggga
tttagttttctacaacaggtggacacctcgactggcagggatatcagagctcgcacacga
tcaaatttcaaacgcaagaaactcctggacaagaaactgctcaagcgtgggacgttcgcg
aagccttattgtatcgatgtgtctagctcggggtcggaggaggatgtgccacagccggag
cagtcggcgtacggtggggattgtgcggatgacgatggcggcagcgatggcaatgaggag
catagagctgtgaagaggaggaaattgaacaggaggcaaagtgcccatagtgatagcgag
gaggatacaacatttgtatgtgatgtcaaggaaggatcaggttctaggagggtacaagaa
ggagcacctcgtaggcaggttaagaaggagggttccaacaagaaaaaggatggctccact
ccacaatgcgtcagaaacaatggaccaaaagttgggagacaaacaaatgggctcaatgga
cagggtggtgtatccttcaagagaaatgtaaagattgctcagaggaggaagcgcaggcaa
gcaacggcagaccaagaaaagtatggtcatttgctcgaccccatgtttaatgaaatagag
agcaaccaatatgagcctgttcctgaagagcaaattgacaggagattgcccctggtattc
gcatttggggatgacgataagctggaagagaaatccaaacatgacaagttacaggatgaa
gatgaactgtggaaagaatttgattttgctttggaatccataaatgtttgttctcacaac
tgcgaggagggtgaaaaggaagatgagcaagaaatccctgcggacaaagcagcttcatgc
atccaagggaagcatgagctcattattgatgagcaaataggacttcgatgcaagcactgc
aactttgttgatcttgaaatcagattcgtacttccctccatggtaaagtcctgtactgaa
agggacatgagaaaagatcacgagttagacttgttttttgatgatatcctaacatcagcg
ggatatgaaggaccacgtgattttggtggtaaaaagactggcctggtttgggatctagtt
cctggggtccgggaggacatgttcccgcaccagcaagaaggttttgagttcatgtggaga
aaactagcaggggggacttcaattgaacagctgaggaacaatgcaaacactattgaaggt
ggctgtgtgatttctcatgcaccagggacagggaagaccagactagcaatcacatttgtt
caatcctactttgcgttttttcccgagtgctgtccagtgataattgctcccagagggatg
cttgctacatgggaacaggagttcagaaaatggaaggtgaaggtcccttttcatgtattg
aactccaaggagattaactggaaagaagacaggaccatcaaacagctggctatcatggat
gaaaatttggcccaaagtttggctagaaacaaattggatcacaaatttaggcgaaagttg
aagttggcatcatggcgtaaagggagcagtataattggtgtgagctatacgcttttcagg
aaactagcgaaccagagcagcatggatgggaacatggtgaggaatctgctccttgagatg
cccgacttgttggtccttgatgaagggcacacaccaaggaacaagaaaagtctcatatgg
aaggttcttgaagaagttcgcaccaaaaagcgaataattctatctggtactccatttcag
aatagctttcttgagctctctaatgtcctgtacctgattagaccaaagtttgcaagacac
ttcgcttctaaaagtttcaagaaaataggccttgaggattactggacatccttgacactg
aataacataacagagaaaaagatagatgaaatccggcaaatactcgatccaattgtgcac
atccataacggtgacattcttcaaaagtctcttccaggattgagagaatcagttgtgatt
ctgaatcctcttcctcatcaaaaggaaatcatcacagcaatggagaacacagtgacaatg
gggactcttgatgcagaatacaagatctcccttgcatctatacacccgttcctcgtcaca
tgtgcaaaactgtcggaaaaagaaacatcttctgtggatgtctctttgctgaagagctta
cggccaaacccgtgcgtaggagtcaaaacaaaatttgttttggaaattgtccgtttgtgt
gaagccatgaaagagcgagtacttgttttcagtcaatatcttgaaccactatctctgatc
atggaccaacttagtaaaatgttcaattggatagaaggtgaggagatcctactgatgagt
ggaaatgtccttgttcaaaatcgagaagctttgatggaggccttcaatgacatgaaaagc
aatgccaaggtaatgcttgcatcaacgaaggcatgctgtgaaggcattacacttatcggg
gcatcacgtgtggttctccttgatgttgtatggaacccttcagttggaaggcaggcgatt
ggccgagcttatagaattggtcaagagaagattgtgtatacatacaatctaatcacagaa
gggacaaaggagaaggacaaatatgataggcaagctaagaaggatcatatgtccaaactg
ctattttcaaaagaaccccatgctgcaggattcaacttgtctcaagaagtgatattcaat
gacaagatattggaagcaatgacatcacatagggagctcaaagacatgtttgtgaagatt
ctccattctcactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277180
Entry
107277180         CDS       T01015                                 
Name
(RefSeq) protein CHROMATIN REMODELING 35-like
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107277180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    107277180
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     107277180
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     107277180
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII
Other DBs
NCBI-GeneID: 107277180
NCBI-ProteinID: XP_015650390
LinkDB
Position
8:complement(8788247..8795463)
AA seq 764 aa
MSTSFILTGCNPSPSIKSCPGPLPLPSLCSAVLFALLYYFGKGRKEVHRLKNWLQQVFVE
NRICGWGYSTTEVLGRICNSSVEKAEERETVIPAISNTEKMGEKQQKSIPRDRKRKGELD
PAADYVKDLWDAFYVTAESTHLDTSEVNNKKQLDNCNHDIHVYEDLGHVCHECGLVVRKA
DSLFHYQWKKASRKRTNVNEVCLKKVGSDAISLSEDFIFSDIAIHPRHAKNIRPHQLEGF
KFLVNNLVTDEPGGCILVHAPGSGEIFMLISFIQGFMARHFTARPLVVLPEGILGTWKRE
FQQWQVEDIPLYDFDSIKADNRVEQLEVLKSWSSKRSILFVGSKHFTQIVCDDRDENAVA
ECRDTLLMVPSLLILDEGHTPSIDETDMLQSARKVQTPCKVVMSGTLFHNHVKEVFNTLD
LVRPGFLKTETFWPIVTRMMGQLEISSARSITEISESMEDTLLNDDNFTRKVNVIRSLGE
LTKDVLHYCKGEDLNEFPVLLDFSVFLELSPKQKDILCKLEEDHGMLKTSAVGAALYVHP
CLSEISEANDVDRDDRVDSLVNSINLGDGVKARFFLNILALANSAGEKLVAFSQYTLPMK
FLERLLVKEMGWHVGKEIFVINGDTSMEDGQLAMDQFNGSADAKVLFGSIKAFGEGISLV
GASRIVILDVHLNPSVTRQAIGSTFRPGQKKKVFVYRLVAADSPEEKAHETAFNKEVIPK
LWFQWSGRCTTEDFKLNQVCIDGSRDELLETDVIRQDIKALYQR
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgagcacctccttcattcttacaggctgcaacccctccccatctattaaaagttgccca
ggaccgttacctcttccttccctctgctctgccgtgctttttgctctgctctactacttt
gggaagggaagaaaggaggtgcataggcttaagaattggctgcaacaagtttttgttgaa
aataggatttgtggttggggatacagcactacagaagttctaggaagaatttgcaattct
tctgtggagaaagcagaagaaagagaaacagtaattccggccattagcaacacggagaag
atgggagaaaaacaacagaaatcaatccctagggacagaaaaagaaaaggcgagctagat
ccagcagcagattatgttaaggatctttgggatgctttctatgtgactgcggaaagcaca
catctcgacacatcagaagtgaataataaaaaacagttggacaattgcaaccacgatatt
catgtttatgaagatctgggccatgtatgccatgaatgtggtttggtcgtgaggaaagct
gactcattatttcactatcagtggaaaaaggcttcaaggaaaagaacaaatgtgaatgag
gtttgcttgaagaaggtaggctctgatgctattagtctctctgaagatttcatattttca
gatattgccattcatccaagacatgccaagaatatccggcctcatcagttggaaggattc
aaattcctggttaataacttggtcactgatgaacctggaggctgcattcttgttcatgcc
ccaggttcaggggaaatatttatgcttatcagtttcattcaaggcttcatggcaagacat
ttcactgcaaggccccttgttgtgcttcctgaagggatattaggtacatggaagagagaa
ttccagcagtggcaagtggaggacataccactgtatgatttcgattctattaaggctgac
aatagagtagagcaactggaagtcctaaaatcttggagctctaagaggagcatactcttt
gttggatccaagcatttcacccaaattgtctgcgatgatagggatgaaaatgctgtagct
gaatgcagggacacgcttcttatggtccccagcttgttgatacttgatgagggccataca
cctagcattgatgagactgatatgctacaatctgcgcgcaaagtgcaaacgccatgcaaa
gtggtcatgtctggtacactcttccataatcatgtcaaggaagtgtttaacaccttggat
cttgtacgcccaggttttctcaagacggagacattctggcccattgttacacgtatgatg
ggtcaactagaaatatcaagtgccaggagtataacagagatctctgagtcaatggaagat
accctgctgaatgatgataacttcacaagaaaagttaatgttatcagaagtcttggagaa
ctaaccaaagatgtgcttcactactgtaagggtgaggacttgaatgaatttcctgtctta
ctagacttcagtgtgttcttggaactcagtcccaagcagaaagacattctttgcaagtta
gaagaagaccatgggatgctcaaaacaagcgctgtaggggctgcactctatgttcaccct
tgcctttcagaaatttctgaagctaatgatgttgatagggatgacagagttgatagtttg
gtcaacagcatcaacctgggagatggggtgaaggccaggttttttctgaacatccttgcg
cttgccaactctgcaggagagaaattagttgcttttagtcagtatacactccccatgaaa
tttttggaaaggctgctggttaaggagatgggctggcatgtagggaaggaaatttttgtg
ataaatggtgatactagcatggaagatggacaattggcaatggatcagttcaacggctct
gccgatgcaaaagttctgtttggttccatcaaggcatttggggagggcatctcccttgtg
ggtgcatcaagaattgtcatcctagatgttcacctgaacccgtctgttacgcgccaagcc
atcgggagcacattcaggcctggacagaagaagaaagtgtttgtgtatagacttgtagct
gctgattctccagaggagaaggcccatgaaactgcattcaacaaggaagtcataccaaag
ctatggttccaatggagcgggcgctgcacaactgaagacttcaagctgaatcaagtctgt
atcgatggctccagagatgaattgttggagactgatgttattcgtcaggatatcaaggct
ttgtatcaaaggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330819
Entry
4330819           CDS       T01015                                 
Name
(RefSeq) DNA repair and recombination protein RAD54
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4330819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330819
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     4330819
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     4330819
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII DEAD DUF2075 YL1 SWI2_SNF2
Other DBs
NCBI-GeneID: 4330819
NCBI-ProteinID: XP_015623131
UniProt: A4PBL4
LinkDB
Position
2:complement(32125899..32134879)
AA seq 980 aa
MPSTSKCNRISRVADEEEEEEIVAVSSDADESESESEVGSGAEEEDDDYVGESSDSAGGS
GSGSGDGDGDEEGGRSDIGDGEGEGGGRRVRSACRGVRANDRERKSQNVDALVRGNLVVR
RQPLIPRILSVSDAAAIARKPFKPPCQNGYSENNEQLARRLSARKRFVPWGSVQPFAVTN
ILPQSPAVSSDDSVENEESLPPGIEPLILWQPEGRDKENSNFSAIKVDHLLVRYLRPHQR
EGVQFMFDCVSGLLNDDGISGCILADDMGLGKTLQSITLLYTLLCQGFDAKPMVKRAVVV
TPTSLVSNWESEIIKWLKGRVQLLALCESTRADVLSGIESFLKPLSRLQVLIVSYETFRM
HSSKFERPGSCDLLICDEAHRLKNDQTLTNKALAALPCKRRILLSGTPMQNDLEEFFSMV
NFTNPGVLGDATYFRRYYEAPIICGREPTASAEEKNLGSERSAELSAKVNLFILRRTNAL
LSNHLPPKIVEVVCCKLTALQTALYNHFIHSKNVKRLISEGTKQSKVLAYITALKKLCNH
PKLIYDTIKSNNSGGSGFDDCLRFFPPELFSGRSGSWTGGGGMWVELSGKMHVLARLLGH
LRLKTDDRIVLVSNYTQTLDLFAQLCRERRYPYIRLDGATSINKRQKLVNQFNDPSRDEF
VFLLSSKAGGCGLNLVGGNRLILFDPDWNPANDKQAAARVWRDGQKKRVYIYRFLSTGTI
EEKVYQRQMSKEGLQKVIQQEQADGKMQGSSLSTEDLRDLFTFHEQIRSEIHENLKCNRC
NKDGCMVLDGSKFDSAATEHEASNSGENSYIDIGGFGAISGCVQKMNSSNQQIGSPSEED
LGSWGHHSDPSTVPDTILQCSSGDEVSFVFTNQIDGKLVPVESMARAATHRTHEVTVNAE
KEVGKINSSNVPGTERQSLLGKNLKMMGFNLKNSSMKFPTKSRRMLPNCLQGMNKTSTSS
DHQQTKKLHVISDASDDDFV
NT seq 2943 nt   +upstreamnt  +downstreamnt
atgccttcgacgagcaaatgcaaccgcatcagccgcgtcgccgatgaggaggaggaggag
gagatcgttgccgtctcctccgacgccgacgaatcggagtcagagtcggaggtggggagt
ggagcggaggaggaggatgacgactacgtgggggagagtagtgactcggccggcggcagc
ggcagtggcagcggcgacggcgacggcgacgaggaaggaggtaggagcgacattggcgat
ggcgagggcgagggcggcgggcggcgagttcggagcgcgtgtcgcggcgtgagagcgaac
gaccgggagaggaaatcgcagaatgtggatgccctcgtcaggggaaatctagttgtaaga
aggcagccacttattccacgtattctttcggtttctgatgcggcagcaatagctcgaaag
ccattcaaacctccctgtcaaaatggatacagtgaaaataatgagcaacttgctcggcgc
ctttcagctcgtaaaagatttgtcccatggggttcggtgcagccatttgcagttacaaat
attcttccacaatcacctgctgtttctagtgatgattccgtagaaaatgaggaatccctt
ccaccaggcatagagccattgattttgtggcaacccgaggggcgtgacaaggaaaacagc
aatttttctgcaatcaaggttgatcacttgcttgtacgttacctccgaccccatcaaagg
gaaggagttcagtttatgtttgattgtgtatctgggttgttaaatgatgatggaatatct
ggttgcattttagctgatgacatgggattggggaagactttacagtcgataactttacta
tacacccttctttgccaaggatttgatgctaagccaatggttaaaagggctgtcgtcgta
acccccacaagtttagttagcaactgggaatctgagataattaaatggttaaaaggcaga
gtgcagttgcttgctctttgtgaaagcacacgcgctgatgttctttctggaattgaaagt
ttcttaaaacctttgagccgtcttcaggtactcatcgtatcttatgagacattccgcatg
cattcttcaaaatttgaaaggccgggaagctgtgacctcctcatatgtgacgaggcccac
aggctgaaaaatgatcagaccctaaccaataaagccttggctgcccttccttgtaaacgg
cgtatcctgttatcaggcaccccaatgcagaatgatctggaggagttcttttcaatggta
aatttcacaaacccaggagttctgggggatgctacatatttccgcagatattatgaagca
ccaatcatttgcggaagagagcccacagcaagtgcagaagaaaagaacttgggatctgag
agatctgcagagctcagtgcaaaagtaaatctgtttatattgagacggacgaatgccctg
ttatccaatcacttgccaccaaagatcgttgaagtagtgtgctgcaagttgactgctttg
caaactgcgctgtacaaccacttcatacattcaaaaaatgttaaacgcttgatatctgaa
ggaacaaagcaatccaaagttttggcttatattactgctcttaagaagctatgcaaccat
ccaaagctgatctatgacaccataaaaagtaataattcagggggctctggttttgacgac
tgcctgcgcttttttcctcctgaactgttttcgggaagatctggatcatggaccggtgga
ggaggaatgtgggtagaactgtctggcaaaatgcatgtcttagctagattactggggcac
ctccgtctgaaaactgatgatcgtattgttcttgtatcaaattatacccagacattggat
ctgtttgcacaattatgtcgggaaaggagatacccgtatattaggcttgatggagcaaca
tccattaataaaaggcaaaagttggtgaaccaattcaatgatccatccagagatgagttt
gtctttctacttagtagcaaggcaggtggctgtgggcttaatttggttggtggaaatcga
ttgattctctttgatcccgattggaaccctgccaatgataagcaggctgctgctagagta
tggagagatggacaaaaaaagagagtgtacatatacaggttcttaagcacaggaaccatt
gaggagaaggtatatcagcgtcagatgtcgaaagaaggtctccaaaaagttattcagcag
gaacaagcagatggcaaaatgcaggggagttctctttcaacagaagatctgcgtgatctt
tttaccttccatgaacaaatcaggtctgaaatacatgaaaatttgaagtgcaatcgctgt
aacaaggatggatgtatggttctcgatggtagcaaatttgattcagcagccactgagcat
gaggcttctaactcaggagagaacagttacattgatattggtggatttggagcgatctct
ggatgtgtgcagaaaatgaatagttcgaatcaacagattggaagtccttctgaagaagat
ttaggaagttggggccatcattctgatccatcaactgtacctgatactatactccagtgt
tcttctggtgatgaggtttcttttgttttcacaaatcagatcgatgggaaacttgttcca
gttgaatctatggcgcgagctgcaactcatcgaacacatgaagtgactgttaatgcagaa
aaagaagtgggaaaaatcaattcttctaatgtacctggaaccgaacggcaatctctactt
ggaaaaaatctgaagatgatgggattcaatttaaagaattcgtctatgaaattcccaact
aagtccagaagaatgctgccaaactgtttgcaagggatgaacaaaaccagcacatcttca
gatcatcaacaaactaaaaagcttcatgttatttctgatgcgtctgatgatgattttgta
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338690
Entry
4338690           CDS       T01015                                 
Name
(RefSeq) SNF2 domain-containing protein CLASSY 4
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4338690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4338690
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     4338690
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     4338690
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII
Other DBs
NCBI-GeneID: 4338690
NCBI-ProteinID: XP_015640539
LinkDB
Position
5:19093417..19099206
AA seq 1445 aa
MDRAARLARRGGGVTVAEYRMVRGRRRGGDAGPVVVIDVEDDGEDAADDSAGGGGGAAAA
VKRRVVVPGAVATRTRSRRMAMAQQAPVTPPAAAEEAPSRRRKRKGAASAEAGGGGPSKR
RVRSSGSAGGRGARKRKEAEADEEEAEAEAEEEAEAEAGTPARGESMEVSQVDGGGSSGR
ADDASHNGNGESRVCNADGIDQASEERPSVAGGDLIEEEHYGNGEASVAGGDRIEEHCGN
VEASVANSNRDGGEIIAGEGTEDRGNTELSVVDPVNEELASDEDDYDDEMLEEKLVGDVI
RAYSNGADLDTNGVDWEAEDEMEFADLDTNVVDWEAEDEMEFDDDNDNDADDDGDNFGGD
ADEGDKSVQMHDFSKVETQDLVSHNVNVSEVRPHEDEEAIKDEMESKGKGSLSFNEGSSY
IEILDSDEEVKVVNDTGNALRRKPLVPAKLPIVPSCVAWRTRSSWGMKEERISYNTYFEV
LSDEPKEDDDDTEVELDDEEDDENDDDCNSASCDEEDEEEEEEREEEEEEAQRRKQKKGI
DSSDDEMIDDAVDCGIDWEEDYPEVDFTRPLTFQKDGSEAPVGSEAFTEQQKRSRFTWEL
ERRKKLKLGMMTNHRLYERDLESDSNSSDSSQNRKNGCQGSGDHRTGRKRKNPLSKSGKK
SSRMLKRQSLMKLLMDKMCSNDDGKSTPFDQKPQIEYSFKDLHPLVFSFGDDDPSPTDRS
EQDAALDMLWADLDFTLESENIGTYYDDEGQEDSLLDHALAPITPCSRGKHEFIIDEQIG
IRCKYCSLVNLEIRFILPLLASNFAEKPAWRNSSCLKTALMCPDLYEQTGTGDGQSQDFH
INGTVWDLIPGVITDMYQHQREAFEFMWTNLVGDIRLNEIKHGAKPDVVGGCVICHAPGT
GKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWEQEFKKWNVNVPFHIMNTTDYSGKED
RDICRLIKKEHRTEKLTRLVKLFSWNRGHGVLGISYGLYMKLTSEKVGCTGENKVRTILL
ENPGLLVLDEGHTPRNERSVIWKTLGKVKTEKRIILSGTPFQNNFLELYNILCLVRPRFG
EMFLTKTRVGRRHCVSKKQRDKFSDKYEKGVWASLTSNVTDDNAEKVRSILKPFVHIHNG
TILRTLPGLRECVIVLKPLPLQKSIIRKVENVGSGNNFEHEYVISLASTHPSLVNAINMT
EEEASLIDKPMLERLRSNPYEGVKTRFVMEVVRLCEALKEKVLIFSQFIQPLELIKEHLR
KIFKWREGKEILQMDGKILPRYRQNSIEVFNNPDSDARVLLASTRACCEGISLTGASRVV
LLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGTGEGDKYDRQAEKDHLSKLVFSTE
DEFSNVRNMLSKAEMEHCSKLISEDKVLEEMTSHDQLKGMFLKIHYPPTESNIVFTYNQI
APELS
NT seq 4338 nt   +upstreamnt  +downstreamnt
atggatcgcgccgcgcgcctcgcccgccgcggcggcggcgtgaccgtggctgaataccgc
atggtgcggggccgccgccgcggaggcgacgcggggccggtggtggtcatcgatgtcgaa
gacgacggggaggacgctgctgatgactccgccggcggtgggggtggagcggcggcggcg
gtgaagaggagggtggtggttccgggggccgtggcgacgcggacgcgatcgcggaggatg
gcgatggcgcagcaggcgcccgtcacgccgccggctgcggcggaggaggcgccgagcagg
aggaggaagaggaagggggcggcgagtgcggaggcgggtggcggagggccgtcgaagcgc
cgcgtgcgatcctcggggtcagcgggcgggcgtggtgcgcgcaagcgcaaggaggcggag
gcggatgaggaggaagcggaagcagaggctgaggaggaagcggaagcagaggcggggact
cccgctcgcggagaatcgatggaggtgtcacaggttgacgggggtggcagcagcgggcga
gccgatgacgcttcgcacaatggtaatggcgagtctcgcgtgtgtaacgcggatggcatt
gatcaggcaagcgaggagcgtccaagtgtcgctggtggggatctaattgaggaggagcac
tacgggaatggggaagccagcgtcgctggtggggatcgaattgaggagcactgcggtaat
gtggaagccagtgtcgccaattcgaatcgtgatggcggtgagatcatcgctggggagggc
acagaggatcgtgggaacacggagttatcagtggtggatccagtgaatgaagagttggct
tccgatgaggatgattacgacgatgaaatgttggaggaaaagcttgtcggagatgtcatt
cgtgcttacagcaatggcgctgatttggatacaaatggagtggactgggaagccgaggat
gagatggaatttgctgatttggatacaaatgtagtggactgggaagctgaggatgagatg
gaatttgatgatgataatgataatgatgctgatgacgacggtgataattttgggggtgat
gcggatgaaggtgacaaatctgtacaaatgcatgacttttctaaggtggaaacacaagat
ttggtgagccacaatgttaatgttagtgaagtgaggcctcatgaggatgaggaggctatc
aaggatgagatggagtcaaagggaaaaggatctctcagttttaatgaagggagctcctat
attgaaattcttgactctgacgaggaagtcaaagtggtcaatgacacagggaatgccttg
agaaggaagccattagtaccagcgaagctaccgattgtgccatcttgtgttgcatggaga
actcggtcatcatggggtatgaaggaggagaggatttcttacaatacatatttcgaggta
ttgtctgatgagccaaaagaggatgatgatgacactgaagtggaattggatgatgaggag
gacgatgaaaacgatgacgattgcaatagtgctagctgtgatgaagaagatgaagaggaa
gaagaggaaagagaggaggaagaggaagaagctcaaaggagaaagcaaaagaaagggatt
gactcatctgatgatgagatgattgatgatgctgtagattgtggcattgattgggaggag
gattacccagaggttgattttactcggccacttacctttcagaaagatggcagtgaggcc
cctgtgggcagcgaggcttttacggagcaacagaagagatcgcgatttacatgggagctt
gagaggaggaaaaaactgaagcttggcatgatgacgaatcatcgtttgtatgaacgagac
ctggaatcagattccaactcatcagattctagtcagaatcgaaaaaatggatgtcaaggg
agtggtgatcacagaactgggaggaaaaggaagaatccattatcaaaatctggtaagaaa
tccagccgcatgttaaagaggcagtctcttatgaagcttctgatggacaagatgtgtagc
aatgatgatgggaagtctactccttttgaccagaagccccagattgagtatagtttcaag
gatttgcatccgttggttttttcatttggggacgatgatcctagtccaactgataggtca
gagcaagatgctgcacttgatatgctatgggctgatttagacttcactttagagtcagag
aacattgggacttattatgatgatgagggccaagaggacagtctgctagatcatgcactt
gctcctattacaccttgttctagagggaagcatgaatttattattgatgagcaaatagga
atcagatgcaaatactgctccttggtaaatctggaaatcagatttattttaccattgctg
gcctccaattttgcagagaaacctgcatggcgaaacagctcttgtttgaagactgcgttg
atgtgtcctgatctttatgaacaaacagggactggtgatggacaatctcaagatttccat
ataaatggaactgtgtgggatctcattcctggcgtcattactgatatgtatcagcatcaa
cgtgaggcatttgagtttatgtggacaaatctagtgggtgatattaggcttaatgaaata
aagcatggggctaagcctgatgttgttggaggatgtgtgatctgtcatgccccagggaca
ggaaagactcgtttggctattgtgtttatccagacatacatgaaggtgttcccagactgc
cgaccggtgattattgcacctcgtgggatgctgtttgcttgggaacaagagttcaagaaa
tggaatgtcaacgttccttttcatataatgaacactactgattactctgggaaggaagac
agagatatatgtagattaataaagaaagagcatcggactgaaaagttgactaggcttgta
aaactgttttcatggaacaggggtcatggtgttcttggaattagttatggtctatatatg
aaactaacatctgaaaaggttggctgcactggagaaaacaaagtgagaactattcttctt
gagaaccctggtttgcttgttctcgatgaagggcacacacctaggaatgagcgcagtgtt
atttggaagacactaggaaaagttaaaaccgagaagcgtataattctatctggaactcct
ttccaaaataattttcttgagctttacaatattctctgtttggtgaggcctaggtttggt
gaaatgtttttgactaaaacaagagtgggtcgaaggcactgtgtctcaaagaagcaacgg
gataaattttctgataaatatgagaaaggagtttgggcttccttaactagtaatgtaact
gatgataatgcagaaaaggtaagatcaatactgaaaccatttgttcatatccataatggg
actattcttcgaactcttccggggctcagagagtgtgtgatagttctgaaacctctaccg
cttcaaaagagtatcattagaaaggtagaaaatgttggatctggtaacaattttgaacat
gagtatgttatttctttagcctccacacatccttcacttgtaaacgcaattaacatgacg
gaagaagaagcttcccttattgataaacctatgcttgaaagattaaggtctaatccttat
gaaggagtaaaaacaaggtttgtaatggaagttgttcgtttgtgtgaagcattgaaagaa
aaggtattgatttttagtcaatttattcagccattagaattgataaaggaacatcttcgt
aagattttcaaatggagagaaggaaaagagattctccaaatggatgggaagatcctcccg
agatatcgtcaaaattcaattgaggttttcaataatccggatagtgacgcgagggtgtta
cttgcatctacaagagcttgttgtgaagggattagcctaacaggggcttctagagttgtt
cttctagatgttgtctggaatccagctgttggaaggcaagctatcagcagagcatttagg
ataggacagaagaaatttgtatatacatacaatttaataacttatggaacaggtgaaggt
gacaaatatgataggcaagcagaaaaggaccacttgtccaagttggtcttctctacagaa
gacgagttcagtaatgttaggaacatgctttcaaaagctgaaatggagcactgttctaag
ttgatatccgaggataaggttctggaggaaatgacttcccatgaccagctgaaaggcatg
tttttaaagattcattatccaccaactgagtcaaacattgtttttacttacaaccagatt
gctcctgagttaagttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340671
Entry
4340671           CDS       T01015                                 
Name
(RefSeq) protein CHROMATIN REMODELING 35
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4340671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4340671
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     4340671
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     4340671
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII ERCC3_RAD25_C RAG1_imp_bd
Other DBs
NCBI-GeneID: 4340671
NCBI-ProteinID: XP_015643525
UniProt: A0A0P0WVB5 Q652G9
LinkDB
Position
6:8097228..8104252
AA seq 946 aa
MYYRRQRKASSEANANVFMPGGPNDISFPASNRDHDWGYGGVGKEWEASYARKLQLMNFL
SSLHQRTANPLVTTRMDANMDTPLEQKQKDSSAIIVLDSDDEDGYTEGCEQLTSENNKQQ
APSGLTSPYTTWIVSSAKDQVNGTLHVDGVQSTQIVPYYGQNAPLINQFPLQTSWQPSIQ
YERVILQKRPEEQRVQDLVAASHAEKIAETQVLLTLPTLPNERKRRKTEPTTLVDVDGGT
NLGKRKRKNHQNQAAVDSNLDLQQNDVPSQSYRTMIEEEKPVKESDGLEDLWKDFSLAAE
CTKLDTNEDMSNEKDVDDENEMDDDCNHDIRIHEDLGHVCRICGMIVRKAETIIDYQWKK
ASRTRTNYYESRSKDADEIDTGAVKVSEDFIVSDIAIHPRHAKQMRPHQLEGFSFLVKNL
VGDKPGGCILAHAPGSGKTFMLISFIQSFLAKYPSARPLVVLPKGILGTWKREFQRWQVE
DIPLYDFYSVKADKRVEQLEVLKSWEAQMSILFLGYKQFSRIICGDGDGNIAAACRDRLL
MVPNLLILDEGHTPRNRETDVLASLKRVQTPRKVVLSGTLFQNHVSEVFNILDLVRPKFL
KMESSRPIARRIMSQVAISGIRSLKGVHDSAFTESVEDTLLNDDNFTRKAHVIRSLRELT
KDVLHYYKGDILDELPGLVDFSVFLKLSTKQKEIVHKIEAYEKFKRSAVGTALYIHPCLS
EISEGDAADRASNLTDATVDSLIESIIIKDGVKAKFFFNILSLANSAGEKLLAFSQYILP
MKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFNNSADAKVLFGSIKACGEGIS
LVGASRVIILDVHLNPSVTRQAIGRAFRPGQQKKVFVYRLVAADSPEVKFHETAFKKEVI
PKLWFEWSELCTTEDFKLNQVDIDDSEDELLEANAIRQDIKALYRR
NT seq 2841 nt   +upstreamnt  +downstreamnt
atgtattaccgcaggcaaaggaaggcttcttctgaggccaatgccaatgtgtttatgcct
gggggtccaaatgatatctcatttcctgcatcaaatagggatcatgattggggatatggc
ggtgttggcaaagaatgggaagctagttatgctcgcaaactccagttgatgaattttctt
tcttcactgcatcaacgcactgcaaatcctttggtaaccactagaatggatgctaacatg
gacactcctttggagcaaaaacagaaggacagctcagcaataatagttcttgattccgat
gatgaggacggatatacggaaggatgtgaacagctcacatctgagaacaataaacaacag
gcaccatctggactcactagtccttacacgacatggattgtatccagtgcgaaagaccaa
gtaaatggaaccttgcatgttgatggagtccaaagcactcaaattgttccatattatggt
caaaatgcaccgttaataaatcagttccctttgcaaaccagctggcaaccatctatccaa
tatgaaagggttatattgcagaaaagacctgaggagcaacgcgttcaagatctggtggca
gcaagccatgcagagaagatagcagaaacacaagttctccttactcttcctactcttcct
aatgagagaaaacgaaggaaaacagaacccaccaccctggtagatgttgatggtggaact
aacctaggaaaaagaaaaaggaaaaatcatcaaaatcaagcagcagttgattcaaacttg
gatttgcaacaaaatgatgttccttcacaaagctacaggactatgatagaagaggagaaa
cctgtaaaagaaagtgatggtctcgaggatctttggaaagatttttcattggctgctgaa
tgtacaaagcttgatacaaatgaagacatgtccaatgaaaaagatgtggatgatgaaaat
gagatggatgacgactgcaatcatgacattcgaattcatgaagatctaggccacgtatgc
cgtatttgtggcatgattgttagaaaggctgaaacaataattgattatcagtggaaaaag
gcttcaaggacaagaacaaattactatgaatcacgttcaaaggatgctgatgagattgat
actggtgctgttaaagtttccgaagatttcattgtctctgatattgccattcatccaaga
catgcgaagcaaatgagaccacatcagttggaaggattcagcttcctggtcaagaatcta
gtgggagacaaacctggaggttgcattctagctcatgctcctggttcagggaagacattt
atgctcataagtttcattcaaagcttcttagcaaagtatccttctgcaaggccccttgta
gtgcttccgaaagggattttaggtacttggaagagggagtttcagcggtggcaagtggag
gacataccactatatgatttctattctgttaaggctgacaaaagagtagagcaactggaa
gtcctcaaatcttgggaagcccagatgagcatactatttcttggatacaagcagttctca
cgaatcatctgtggtgatggagatggaaacattgcagctgcgtgtcgggacaggctgctt
atggtacccaacctacttatactagacgagggtcatacaccaagaaatcgggagacagat
gtactggcatcactaaaaagagtccaaacaccacgcaaagtggtcctgtctggtacactt
ttccagaaccacgtttcggaagtgtttaacatcttggaccttgtgcgccctaagtttctc
aagatggaatcatcccgtcctattgctagacgtataatgagtcaggtagcaatatcaggt
atcaggagtttaaaaggggttcatgacagtgcattcactgagtcagtggaagacaccctg
ctgaacgatgacaacttcactagaaaagcccatgttattagaagtcttagagaattaaca
aaagatgtgcttcactattacaagggtgatatcttagatgaactacctggcctagtagat
tttagtgtgtttttgaaactcagtaccaagcagaaagaaattgttcacaagatagaagcc
tatgagaagttcaaaagaagtgcagtggggactgcattgtacattcatccctgcctgtca
gaaatttcagagggtgatgctgcagatagggcgagcaacttgacagatgccactgttgac
agcttgattgagtctatcatcattaaagatggggtgaaagccaagtttttctttaacatt
ctgtctcttgctaactctgcaggagagaagttgcttgccttcagtcaatatatacttccc
atgaaatttttggaaaggttgttggttaagaggctgggctggcatgtagggaaggagatt
ttcatgatatctggtgatactagtgcagacgacagagaagtggcgatggatcagtttaac
aactctgccgatgcaaaagttttgtttggttccatcaaggcctgtggagagggaatctcc
cttgttggtgcatctcgagtcatcattctagatgttcatttgaacccatctgtcacccgt
caagcaattggacgtgcattcaggcccggacagcagaagaaagtgtttgtgtacaggctt
gttgctgctgattctccagaggtgaagttccatgaaactgcattcaagaaagaagttatc
ccaaagctatggtttgaatggagtgagctctgcactactgaagacttcaaactgaatcaa
gttgatattgatgactctgaagatgaacttttggaggctaatgctatccgccaggatatc
aaggctttgtatagaaggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343066
Entry
4343066           CDS       T01015                                 
Name
(RefSeq) protein CHROMATIN REMODELING 35 isoform X1
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4343066
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4343066
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     4343066
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     4343066
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII ERCC3_RAD25_C RAG1_imp_bd
Other DBs
NCBI-GeneID: 4343066
NCBI-ProteinID: XP_015647718
LinkDB
Position
7:complement(14505905..14512599)
AA seq 966 aa
MAAAGRDPPATPSSRMYYCRQRKASSEVNANVFVPGGQNGISFPASNRAHDWGYGGVREE
WEASYARKLQLINFLSSLHQRTANSLITTRMDANMDTPLEQKQKDSSAIIVLDSDDEDEA
ERCEQLASENNKQQAPSGPTSPCTTWIVSSAKDQVNGTLHVDGVQSTQIVPYGQNAPLIN
QSPLQTSWQPSIQYERVILQRRPEEQRVQDLVAASHAEKIAETQVFLTLPTLPNERKRRK
SEPTTLVDGDGGTNLGKGKRKNHQNQAAVDSILDLQQTVVPLQQNDVPSQSYRTMIEEEK
PVKESDGLEDLWKDFSLAAECTKLDTNEDMSNEKDVDDENEMDDDCNHDIRIHEDLGHVC
RICGMIVRKAETIIDYQWKKASRTRTNYYESRSKDADDIDTGAVKVSEDFIVSDIAIHPR
HAKQMRPHQLEGFSFLVKNLVGDKPGGCILAHAPGSGKTFMLISFIQSFLAKYPSARPLV
VLPKGILGTWKREFQRWQVEDIPLYDFYSVKADKRTEQLEVLKSWEARMSILFLGYKQFS
RIICGDGDGNIAAACRDRLLMVPNLLILDEGHTPRNRETDVLASLKRVQTPRKVVLSGTL
FQNHVSEVFNILDLVRPKFLKMESSRPIARRIMSQVAISGIRSLKGVHDSAFTESVEDTL
LNDDNFTRKSHVIRSLRELTKDVLHYYKGDILDELPGLVDFSVFLKLSTKQKEIVHKIEA
YEKFKRSAVGTALYIHPCLSEISEGDAADRATNLTDATVDSLIESIIIKDGVKAKFFFNI
LSLANSAGEKLLAFSQYILPMKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFN
NSADAKVLFGSIKACGEGISLVGASRVIILDVHLNPSVTRQAIGRAFRPGQQKKVFVYRL
VAADSPEVKFHETAFKKEVIPKLWFEWSELCTTEDFKLNQVDIDDSEDELLEANAIRQDI
KALYRR
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggccgctgccggcagggacccgccggcgacgccatcctccagaatgtattactgcagg
caaaggaaggcttcttctgaggtcaatgccaatgtgtttgtgcctgggggtcagaatggt
atttcatttcctgcatcaaatagggctcatgattggggatatggcggtgttcgcgaagaa
tgggaagctagttatgctcgcaaactccagttgatcaattttctttcttcactgcatcaa
cgcactgcaaattctttgataaccactagaatggatgctaacatggacactcctttggag
caaaaacaaaaggacagctcagcaataatagttcttgattccgatgatgaggacgaagca
gaaagatgtgaacagctcgcatctgagaacaataaacaacaggcaccatctggacccact
agtccttgcacaacatggattgtatccagtgcgaaagaccaagtaaatggaaccttgcat
gttgatggagtccaaagcactcaaattgttccatatggtcaaaatgcacctttaataaat
cagtcccctttgcaaaccagctggcaaccatctatccaatatgaaagggttatattgcag
agaagacctgaggagcaacgcgttcaagatcttgtggcagcaagccatgcagagaagata
gcagaaacacaagttttccttactctgcctactcttcctaatgagagaaaacgaaggaaa
tcagaaccgaccaccctggtagatggagatggtggaactaacctagggaaaggaaaaagg
aaaaatcatcaaaatcaagcagcagttgattcaatcttggatttgcaacaaactgttgtt
cctttgcaacaaaatgatgttccttcacaaagctacaggactatgatagaagaggagaaa
cctgtaaaagaaagtgatggtctcgaggatctttggaaagatttttcattggctgctgaa
tgtacaaagcttgatacaaatgaagacatgtccaatgaaaaagatgtggatgatgaaaac
gagatggatgacgattgcaatcatgacattcggattcatgaagatctaggccatgtatgc
cgtatttgtggcatgattgttagaaaggctgaaacaataattgattatcagtggaaaaag
gcttcaaggacaagaacaaattactatgaatcacgttcaaaggatgctgatgatattgat
actggtgctgttaaagtttctgaagatttcattgtctctgatattgccattcatccaaga
catgcgaagcaaatgagaccacatcagttggaaggattcagcttcctggtcaagaatcta
gttggagacaaacctggaggttgtattctagctcatgctcctggttcagggaagacattt
atgctcataagtttcattcaaagcttcttagcaaagtatccttctgcaaggcccctcgta
gtgcttccgaaagggattttaggtacttggaagagggagtttcagcggtggcaagtggag
gacataccactatatgatttctattctgttaaggctgataaaagaacagagcaactggaa
gtcctcaaatcttgggaagcccggatgagcatactatttcttggatacaagcagttctca
cgaatcatctgtggtgatggagatggaaacattgcagctgcgtgccgggacaggctgctt
atggtccccaacctacttatactagacgagggtcatacaccaagaaatcgggaaacagat
gtactggcatcactaaaaagagtccaaacaccacgcaaagtggtcctgtctggtacactt
ttccagaatcatgtttcggaagtgtttaacatcttggacctcgtgcgccctaagtttctc
aagatggaatcatcccgtcctatcgctagacgtataatgagtcaggtagcaatatcaggt
atcaggagtttaaaaggggttcatgacagtgcattcactgagtcagtagaagacaccctg
ctgaatgatgacaacttcactagaaagtctcatgttattagaagtcttagagaattaaca
aaagatgtgcttcactattacaagggtgatatcttagatgaactacctggcctagtggat
tttagtgtgttcttgaaactcagtaccaagcagaaagaaattgttcacaagatagaagcc
tatgaaaagttcaaaagaagtgcggtggggactgcattgtacattcatccctgcctgtca
gaaatttcagagggtgatgctgcagatagggcgaccaacttgacagatgccactgttgac
agcttgattgagtctatcatcattaaagatggggtgaaagccaagtttttctttaacatt
ctgtctcttgctaactctgcaggagagaagttgcttgccttcagtcaatatatacttccc
atgaaatttttggaaaggttgttggttaagaggctgggctggcatgtagggaaggagatt
ttcatgatatctggtgatactagtgcagacgacagagaagtggcgatggatcagtttaac
aactctgccgatgcaaaagttttgtttggttccatcaaggcctgtggagagggaatctcc
cttgttggtgcatcgagagtcatcattctagatgttcatttgaacccatctgtcacccgt
caagcaattggacgtgcattcaggcccggacagcagaagaaagtgtttgtgtacaggctt
gttgctgctgattctccagaggtgaagttccatgaaactgcgttcaagaaagaagttata
ccaaagctatggtttgaatggagtgagctctgcactactgaagacttcaaactgaatcaa
gttgatattgatgactctgaagatgaactattggaggctaatgctattcgccaggatatc
aaggctttgtatagaaggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344376
Entry
4344376           CDS       T01015                                 
Name
(RefSeq) SNF2 domain-containing protein CLASSY 1
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4344376
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4344376
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     4344376
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     4344376
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII SAWADEE
Other DBs
NCBI-GeneID: 4344376
NCBI-ProteinID: XP_015646417
LinkDB
Position
7:29468644..29475499
AA seq 1334 aa
MLKGPVDHRSHPISATPFEVFYDGSWHGVNCIRIRNGNLFVKFIYSGSTVEHNVDGDCLR
LRSRRATCSDCSNVLKPGVDVCVQSSHTPEASSQGGTNASVLLRHDARLITIKKNHQEDK
CLCLFVVILYKNQCPGNAEKVITDRRAEVVTINDIFLLQKLQPEVHEGSMKWSFSKDRLS
LNKGRLISARFSSEITHLIVLSILRGMEFNIKLVEGQIVYQIIKGDQAQWNLDSMAIPPG
FGNTMEIISFQLRDEALRPTITNIPITHVKKNNITEDMRFTVKSEMDSELDRALDVEILY
EHVDLRRSKRLKTQPDRFTSYDTPRFLSGYKKKEASSSPTKHVRGAVHCDSPVDDSKKEV
ESCCVEIPGNVTQKQTGVHSPMVDEKSNSPEGQHKNTTKRTTCSLVKEKASSPEGQHEKT
TKRTTCALPVKEKASSPEGQHKNTIKRTTCSLPVKEEPSSVEIEEKSSKEQSAPEFHIPR
TPAQNKEKHNRPPFSCKPKLFTSSGTLGVNCEPAFCQKVGGKRKRHMCEREYKQMIDQCI
GNIESEMERDSMFNFDANMMNYVQHSYREEDFTWPPSADNQEVEEDELEELWKEMDYSLT
TLALLEQKQVMAQSRINMLVDNFDGLRLDCLTLTDDYRCYYQKKEKFAESGSVNESTDYF
GKVGGIPCHHECILDEELGLACRLCNVVCTEAKDIFPEMFNGNDYKDRPGCSNICLDDDI
LDPSLLANLAPELSELKNSGSVWSAISDLDPKLLPHQRKALDFLWKNLAGSIQVEGMDNS
NVSTGGCVIAHTPGSGKTLLLISFLVSYMKAHPRSRPLVLTPKAAIHTWKREFEKWGISL
PLHVFHHANRSGKPLGAMDSKLRSLLNNFHRPTWTNMRLMDSLDKLFKWHAHPSVLLMTY
SSFLGMTKQDSKVRNRYREFIAEVLMNNPGLLILDEGHNPRSNKSKLRKLLMKVKTEFRI
LLSGTAFQNNFEEYFNTLCLARPRFIGDIMSELVPERKRETVGRRAKHQEAVARRAFVEK
VGQKIESDNKHIRSDGISLLNKLTRGFIDSFEGAKLINLPGIHVYTVFMKPTDIQEEMLA
KVTMPKLGSSRFPLEVELLITIGSIHPWLIKTTKAVSTFFSPAEVKKVERYKRDFAAGCK
AKFVIDLLHKSSFRGERVLIFCHNVSPITFLVKLIEMVFGWRLGEEVLVLQGDQELPVRS
DVMDKFNGDSAGKRKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAIARAFRRGQ
ERTVYVYLLVASGTWEEEKYNSNRRKAWMSKMVFLGRYVDDSSQNRVTDIDDEVLKELAD
EDHTGTFHMIVKQD
NT seq 4005 nt   +upstreamnt  +downstreamnt
atgctcaagggacctgtggaccatcggagccatcccatcagtgcaactccatttgaggtg
ttttatgatggatcatggcatggggtaaattgtataaggataaggaacggcaacctgttt
gttaaatttatctactctggatcaacagtcgagcataatgttgatggggattgtctacgc
ttacggtcgagaagggcgacttgttctgattgttcaaatgttctcaagccaggtgttgat
gtctgtgtgcagtcatctcatacacccgaagcaagttcacaaggaggaacaaacgcttct
gtgttactgcgtcatgatgcaaggcttatcacaatcaagaagaatcatcaagaagataag
tgtctctgcttgtttgttgttatactctacaagaaccagtgtcctggcaatgcagaaaaa
gtgataactgatagaagagcagaggtagtaaccataaacgatattttcctcctgcaaaag
cttcaacctgaggtccatgaaggaagcatgaaatggagtttttcaaaggatcgcctctct
cttaataaaggcaggctaataagtgctagattctcctcagaaattacacatctgatagtc
ttgtcgatcttgaggggaatggaattcaacatcaaattggtagaaggccagatcgtttat
caaataatcaaaggagatcaagcacaatggaatcttgattccatggccatccctccaggc
ttcgggaatacaatggagataatatcattccaattgcgtgatgaggccttgcgcccaaca
atcacaaatatccctatcactcatgtgaaaaagaacaatatcacagaagacatgagattc
actgtgaagagtgaaatggatagtgaactggatagggcattagatgttgagatcttgtat
gagcatgtggatctgaggcgttcaaagcgcttgaagactcagccagatcgctttacaagt
tacgatacacctaggttccttagtggctacaagaagaaagaagcaagttcatcacccacc
aagcatgtaaggggagctgtgcattgtgattcaccggtagacgattccaaaaaagaagta
gaatcatgctgtgtagagattccagggaatgttacacagaagcaaacaggtgtacactct
cccatggtcgatgaaaagtcaaactctccagaaggacagcataagaacacaactaagaga
actacatgctctcttgtgaaggaaaaagcaagctctccagaaggacagcatgagaaaaca
acaaagagaactacatgcgctttgcctgtgaaggaaaaagcaagctctccagaaggacag
cataagaacacaataaagagaactacgtgctctttgcctgtgaaggaagagccaagctca
gtggaaatagaggagaaaagctcaaaagagcaaagtgcaccggagtttcacattccacgg
acacctgcacagaataaagagaagcataatcgtcctcctttctcatgtaagccgaagcta
tttacttcatcaggcacccttggtgttaactgtgaaccagcattctgccaaaaggtgggc
gggaaaagaaagaggcacatgtgcgagagagaatacaaacaaatgattgaccaatgcata
ggaaacattgagagtgaaatggagagggactctatgtttaacttcgatgccaatatgatg
aattacgttcagcattcttatcgagaagaggattttacatggccaccttctgctgataac
caagaggtggaggaggatgagcttgaagaactgtggaaagaaatggattattcactgacg
acattagcacttcttgagcaaaagcaggtgatggctcaaagtaggataaacatgctggtg
gataattttgatgggttgaggctggattgtttaactttgacggatgattacagatgctat
tatcaaaaaaaagaaaagtttgcagagtcaggatcagttaatgagagcaccgattatttt
ggaaaagttggaggaataccatgccatcatgaatgcatactggatgaggagcttggacta
gcatgcagattatgcaatgttgtatgcactgaggcaaaggatatatttccagaaatgttc
aatggaaatgactacaaggacagacctggatgcagcaatatttgccttgatgatgatata
cttgatccttctcttcttgcaaacttggcaccagagttgtcagaattgaagaactcaggg
agcgtgtggagtgcaatatctgatcttgatccaaagctgcttcctcaccagagaaaagca
ctagattttctgtggaaaaatttggcggggtcgatacaggttgaaggaatggataactca
aatgtcagtacaggtggctgtgtgatagcacacactcctggatctgggaaaacactgctg
cttatctcatttctggtgagttacatgaaagctcacccaagaagccggccattggtcctt
actccaaaagctgcaattcatacatggaagagagaatttgagaaatggggcatttcactt
cctttacatgtgttccaccatgctaacagaagtggcaagccgttgggggcaatggattct
aaactgcggtcgttattaaataattttcacagaccaacctggacaaatatgcgccttatg
gattctttggacaaactattcaagtggcatgcacatccaagcgtcctcctcatgacatac
tcatctttcttagggatgacgaaacaagactcaaaagtgcgaaaccgataccgagaattt
atcgcagaggtcctgatgaacaaccctggactcttgattcttgacgaggggcacaaccca
agaagcaacaagtccaagttgaggaagctgctgatgaaggtgaagactgagttcagaatc
ctcttatctggcacggccttccagaacaactttgaagagtacttcaacaccctatgtttg
gccagacctcggtttatcggtgatatcatgagtgaactagtgccagagaggaaaagagaa
acagttggcaggagagccaaacatcaagaagcagtggcacgccgcgcctttgtggagaaa
gtgggccagaagattgagtctgacaacaaacatatcagaagtgatggtatcagtttgcta
aacaagcttactcgtggattcatagattcattcgagggagcgaagctgatcaaccttcca
gggatacatgtgtataccgtgttcatgaagcccacggacattcaggaggagatgctggca
aaggtaacaatgcccaagctcgggtcgtcccggttccctctagaggttgagctgctcatc
acgattggctccatccatccttggctcataaaaacgacgaaggccgtcagcaccttcttc
agtccagccgaagtgaagaaggttgagaggtacaagcgagacttcgcggcggggtgcaag
gccaaatttgtgatcgatctgctgcacaagtcgtcgttcagaggggagagggtgctgata
ttctgccacaacgtgtccccgatcacgttcctggtgaagctgatagagatggtgtttggg
tggcggctcggggaggaggtgctggtgcttcagggtgatcaggagctgcctgtccggtcc
gatgtgatggacaagttcaacggcgacagcgcggggaagaggaaggtgctgatcgcgtcg
acaacggcatgcgcggaggggatcagcttgacaggcgcgtcgaggctggtgatgctggac
tcggagtggaaccactccaagacgaggcaggcgatcgcgcgggcgttccggcgtgggcag
gagaggacggtgtacgtctacctcctggtggcatctgggacatgggaggaggagaagtac
aacagcaacaggaggaaagcttggatgtccaaaatggtgttcctgggacgctatgttgat
gattcctcgcaaaaccgtgtcactgacatcgatgatgaggtcttgaaggagcttgccgat
gaagatcacaccggcaccttccatatgattgtcaagcaagactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267584
Entry
9267584           CDS       T01015                                 
Name
(RefSeq) protein CHROMATIN REMODELING 35
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    9267584
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    9267584
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     9267584
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     9267584
SSDB
Motif
Pfam: SNF2-rel_dom ResIII CTD11 A2L_zn_ribbon
Other DBs
NCBI-GeneID: 9267584
NCBI-ProteinID: XP_015629455
LinkDB
Position
3:3506998..3513181
AA seq 687 aa
MDSDSCKRRKHESGHDSSSRVQSQSSILSRNRILCHQLLEQCDDLKYGSSTNDYKAISMK
RLELISILQKLQEVPIQLPYASPLKSSETNRLVQDGRNSSCRNIIDLDSDNDEDYTFANV
DNIGANTTVVLVDSDDGDSVASFVDEKSSDSKQNANYIEESVLPEQHAQQQEISMLDNEN
ISSEAQAVKKGKDSMDINDVIYNKSGHEEIGEEEAQAENVQIKGNLKKEIISVASDELAC
EVMRSQSPTNGNFDQYDNSSPVDELEGLWMDMYLAMACSKTVGSDHNIVPSENSCEQAED
ECQHDFLMKDDLGIVCRVCGLIQQRIENIFEYQWKKRKQSYRARPSEHRNSSDADAIDKT
SGAILEVVPDALCLHPQHSQHMKPHQVEGFNFLVKNLADENNPGGCILAHAPGSGKTFLI
ISFVHSFLAKYPAGRPLIILPKGILSTWRTEFLHWQVDDIPLYDFYSSKADKRSEQLKVL
NLWEESRSILLLGYQQFACIVSDHTSDTEAIMCQEKLLKVPSLVILDEGHTPRNEETDLL
TSLENIRTPRKVVLSGTLFQNHVREVFNILKLVRSKFLKMDKSRAIVNCILSKVDLMGKS
ARSKNISDKDFFDLVQEHLQKDGNDKMRANANKADADDGNVTNRKIGSIISGIDINDGVK
AKFVHNLLSLSEATGGKGYWWLNSGSA
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggattctgatagctgcaaaaggcggaagcatgaaagcggtcacgatagctcttcacgg
gtccagtcccagtcaagcatccttagtcgtaacagaattttgtgtcatcagttgcttgaa
caatgcgatgacttgaagtatgggagctccacgaatgattacaaggcaatcagtatgaag
cggcttgaacttatcagcatcctacaaaagctgcaagaagtacctatccagttgccatat
gccagtccactcaagtcatcagaaacaaatcgccttgtgcaagatggaagaaactctagt
tgtcgtaatataattgacttggattcagacaatgatgaagattatacttttgctaatgtg
gacaatattggtgctaacacaacagttgttttagttgattctgatgacggggacagtgtt
gcatcctttgtagatgaaaaatcatctgattccaagcaaaatgcgaattatattgaagaa
agcgttctgcctgagcagcatgcccaacaacaggaaatctccatgctggataatgaaaac
atcagttctgaagcacaagcagttaagaaaggaaaggatagtatggacatcaacgatgtt
atttacaacaagagtggtcatgaggagataggggaagaggaagcacaagctgaaaatgtc
cagataaaagggaacttaaagaaagagatcatctctgttgcttctgatgaactagcttgt
gaagttatgcgcagtcagtcaccaaccaatggaaattttgatcaatatgacaacagcagc
ccagttgatgagctggaaggactttggatggacatgtaccttgcaatggcatgttcaaag
actgttggaagcgatcataacattgtcccatcagagaattcttgtgaacaagcagaggat
gaatgccagcacgatttcctgatgaaagatgatttgggcattgtctgtcgtgtttgtggt
ctgatccagcaacgtattgaaaatatttttgagtaccagtggaaaaagcggaagcaatcg
tacagagcacgtccctcagaacacagaaattctagtgatgcagatgcaattgacaaaact
tcaggagctattctcgaagtggtccctgatgctctatgcctccaccctcaacattcacag
catatgaaacctcaccaagtggaaggtttcaatttcctggtcaagaacttggcagatgag
aacaaccctggtggctgtattctggcacatgcaccaggttctgggaagacttttttgata
attagttttgtccacagcttcctagccaaataccctgctggaaggccattgattattctc
ccaaagggaattctatcaacatggagaaccgaatttcttcattggcaagttgatgatatt
cctttgtatgacttctactcctccaaagctgacaaacggtctgaacaactcaaagttttg
aacttgtgggaggagagcagaagtatcctgttgttgggctatcaacagtttgcatgcata
gtttctgatcacacttctgatacagaagccatcatgtgccaggagaagttactgaaggtc
ccgagccttgtcattctagatgaaggacacactccaagaaacgaggaaacagacttgctc
acttcactggaaaacatccgaactcctcgtaaagtagtcctctcaggaaccttgttccag
aaccatgtgagggaggttttcaacattttgaaacttgtccgatccaaattcttgaagatg
gacaaatctcgtgctattgttaactgcatactaagcaaggtggacttgatggggaagagt
gcacgatcaaagaatatctcagataaggacttctttgatttggttcaagaacaccttcag
aaagatggaaatgacaagatgagagcgaatgccaataaagctgatgcagatgatggaaat
gtcaccaataggaagatcggttccatcatatccggaattgatatcaacgacggggtgaag
gccaagtttgtacacaatctgttgtctctttcagaagccacgggagggaagggttactgg
tggctcaactcaggatcagcgtga

DBGET integrated database retrieval system