KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277102
Entry
107277102         CDS       T01015                                 
Name
(RefSeq) 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase 1, chloroplastic
  KO
K12502  MPBQ/MSBQ methyltransferase [EC:2.1.1.295]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00112  Tocopherol/tocotorienol biosynthesis, homogentisate + phytyl/geranylgeranyl-PP => tocopherol/tocotorienol
osa_M00933  Plastoquinone biosynthesis, homogentisate + solanesyl-PP => plastoquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    107277102
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.295  2-methyl-6-phytyl-1,4-hydroquinone methyltransferase
     107277102
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Ubie_methyltran Methyltransf_31 Methyltransf_12 Methyltransf_23 MTS GidB Methyltransf_2 Met_10 PCMT RrnaAD Methyltransf_16 MetW CMAS PrmA
Other DBs
NCBI-GeneID: 107277102
NCBI-ProteinID: XP_015647024
UniProt: Q6ZLD3
LinkDB
Position
7:complement(4181681..4185098)
AA seq 330 aa
MKEMVSSSTFRAPGGLGFLGPSKIGLIPLRNRSGVRSRVKYIAPKCAVSSARPASQPRFI
QHKKEAFWFYRFLSIVYDHVINPGHWTEDMRDDALEPAELYHHGLKVVDVGGGTGFTTLG
IVKHVDNENVTLLDQSPHQLEKARQKVALNGVNIIEGDAEDLPYPTDTFDRYVSAGSIEY
WPDPQRGIREAYRVLKLGGVACLIGPVHPTFWLSRFFADMWMLFPKEEEYIEWFQKAGFQ
DVKIKRIGPKWYRGVRRHGLIMGCSVTGVKRSSGDSPLQLGPKAEDVEKPVNPFTFIFRF
VMGTICASYYVLVPIYMWMKDQIVPKDQPI
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaaggaaatggtttcttcctctacatttagagctcccggtggattaggattcttgggg
ccttccaaaataggtttgattcctttgagaaatagaagtggtgtgagatcaagggtaaag
tatatcgcaccaaagtgcgcggtctcctctgctaggccagcatcacaacctaggttcata
caacacaagaaggaagcattctggttctataggttcctttccattgtgtatgaccatgtc
ataaacccggggcattggaccgaggacatgagggatgatgcattggagcctgctgaactc
taccaccatgggctcaaggttgtcgatgttggtggtggcactgggttcaccacattgggg
attgtcaagcatgtggacaatgagaatgtcacactgctagaccagtctccacaccagctt
gagaaggccaggcagaaggtggcactgaatggggtgaacatcattgagggtgacgctgag
gacctcccctacccgactgacacatttgatcgctatgtctctgctgggagcattgagtac
tggcctgatccacaacgaggaatcagggaagcctacagggtcctgaagctaggtggagtt
gcctgtttgattggcccggttcacccaaccttttggctgtcacgcttcttcgccgacatg
tggatgctcttccccaaggaagaagagtacatagaatggttccagaaggcagggttccag
gatgtcaagatcaagagaattgggcccaaatggtaccgcggtgttcgacgccatggcctg
atcatggggtgctctgtgacaggcgtgaagcgatcgtctggcgattcccctttgcagctt
ggtccaaaggctgaagatgttgagaaaccagtgaatcctttcaccttcatcttccgcttc
gtcatggggacgatttgcgcttcttattatgtgctggtacctatctacatgtggatgaaa
gatcagattgtccccaaggaccaaccaatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352791
Entry
4352791           CDS       T01015                                 
Name
(RefSeq) 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase 2, chloroplastic isoform X2
  KO
K12502  MPBQ/MSBQ methyltransferase [EC:2.1.1.295]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00112  Tocopherol/tocotorienol biosynthesis, homogentisate + phytyl/geranylgeranyl-PP => tocopherol/tocotorienol
osa_M00933  Plastoquinone biosynthesis, homogentisate + solanesyl-PP => plastoquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4352791
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.295  2-methyl-6-phytyl-1,4-hydroquinone methyltransferase
     4352791
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Ubie_methyltran Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_2 RrnaAD MTS GidB DUF5997 PCMT
Other DBs
NCBI-GeneID: 4352791
NCBI-ProteinID: XP_015619522
UniProt: Q2QM69
LinkDB
Position
12:complement(26101115..26103556)
AA seq 348 aa
MAMASSAYAPAGGVGTHSAPGRIRPPRGLGFSTTTTKSRPLVLTRRGGGGGNISVARLRC
AASSSSAAARPMSQPRFIQHKKEAFWFYRFLSIVYDHVINPGHWTEDMRDDALEPADLYS
RKLRVVDVGGGTGFTTLGIVKRVDPENVTLLDQSPHQLEKAREKEALKGVTIMEGDAEDL
PFPTDTFDRYVSAGSIEYWPDPQRGIKEAYRVLRLGGVACMIGPVHPTFWLSRFFADMWM
LFPKEEEYIEWFKKAGFKDVKLKRIGPKWYRGVRRHGLIMGCSVTGVKREHGDSPLQLGP
KVEDVSKPVNPITFLFRFLMGTICAAYYVLVPIYMWIKDQIVPKGMPI
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggcgatggcctcctccgcctacgccccagcgggcggcgttggcacccactccgcgccg
ggcaggatcaggccgccgcgcggcctcggcttctccaccaccaccaccaagtcgaggccc
ctcgtgctcaccaggcgtgggggaggcggcggcaacatctccgtggctcggctgaggtgc
gcggcgtcgtcgtcgtcggcggcggcgaggccgatgtcgcagccgcggttcatccagcac
aagaaggaggcgttctggttctaccgcttcctctccatcgtctacgaccacgtcatcaac
ccgggccactggacggaggacatgcgggacgacgccctcgagcccgccgacctctacagc
cgcaagctcagggtcgtcgacgtcggcggcgggacggggttcaccacgctcgggatcgtc
aagcgcgtcgacccggagaacgtcacgctgctcgaccagtccccgcaccagctcgagaag
gcccgggagaaggaggccctcaagggcgtcaccatcatggagggcgacgccgaggacctc
cccttccccaccgacaccttcgaccgctacgtctccgccggcagcatcgagtattggccc
gatccgcagcgaggaatcaaggaagcttacagggttttgaggcttggtggagtggcttgc
atgattggccccgtgcacccaaccttctggctgtctcgctttttcgctgacatgtggatg
ctcttcccgaaggaagaggagtatattgagtggttcaaaaaggcagggttcaaggatgtc
aagctcaaaaggattggaccaaaatggtaccgtggtgtccgaaggcatggcctgattatg
ggatgctctgtgacgggcgtcaaaagagaacatggagactcccctttgcagcttggtcca
aaggttgaggatgtcagcaaacctgtgaatcctatcaccttcctcttccgcttcctcatg
ggaacaatatgtgctgcatactatgttctggtgcctatctacatgtggataaaggaccag
attgtgcccaaaggcatgccgatctaa

DBGET integrated database retrieval system