KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277220
Entry
107277220         CDS       T01015                                 
Name
(RefSeq) red chlorophyll catabolite reductase-like
  KO
K13545  red chlorophyll catabolite reductase [EC:1.3.7.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    107277220
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.12  red chlorophyll catabolite reductase
     107277220
SSDB
Motif
Pfam: RCC_reductase
Other DBs
NCBI-GeneID: 107277220
NCBI-ProteinID: XP_015614207
UniProt: G9I8W2
LinkDB
Position
10:complement(12890225..12894642)
AA seq 325 aa
MLPAPTSCCRAAPPPSRPSCLSPAAAAAARRRRMAAVRSAAASASRVSREEAVARMPPLA
HREVMLAVAGEAEARLGARLLPSEVPADVAWFGNAAGDAVGSVDVRRGAPGSSIAFMLEA
WFHRELPGGGGGAIDITALIVNLNGATDAPHLVMEFIQGGPASLIVLLDLLPRVDLPLHP
SYIHRYYAATGLDARARRRVAGLVPQSRPYVSPSLLVRSLWSPAAVVADVQCGEGPGGAA
ALDGIVRGELAATAMDVLGVWLEHCAGGGGGGEMEAAERERMVARDRKVAAAELEVNLAA
NLPRMFDAGVADRVVAEIRKAFMGS
NT seq 978 nt   +upstreamnt  +downstreamnt
atgcttcctgctccgaccagctgctgccgcgccgccccgccgccgtctcgcccctcctgc
ctgtcgccggccgcggcggcggcggcgaggaggaggaggatggcggcggtgaggagcgcg
gcggcgtcggcgtcgcgggtgagcagagaagaggcggtggcgaggatgccgccgctggca
caccgggaggtgatgctggcggtggccggcgaggcggaggcgcggctcggggcgcggctg
ctgccgtcggaggtgcccgccgacgtcgcgtggttcggcaacgccgccggggacgccgtc
ggctccgtcgacgtgcgccgcggcgcgccgggatcctcgatcgccttcatgctggaggcg
tggttccaccgcgagctccccggcggcggcggaggcgccatcgacatcaccgccctcatc
gtcaacctcaacggcgccaccgacgcgccgcacctcgtcatggagttcatccagggcggg
ccggcctccctcatcgtcctcctcgacctcctcccgcgcgtcgacctcccgctccacccc
tcctacatccaccggtactacgccgccacgggcctcgacgcccgcgcccgccgccgggtc
gccggcctggtgccgcagtcccgcccctacgtctcgccgtcgctgctcgtccgcagcctg
tggtcgccggcggccgtcgtggccgacgtccagtgcggcgagggccctggaggggcggcg
gcgctggacgggatcgtccgcggcgagctcgccgccacggccatggacgtgctcggcgtc
tggctcgagcactgcgccggcggcggcggcggcggggagatggaggcggcggagagggag
cggatggtggcgagggacaggaaggtggcggcggcggagctggaggtcaacctggcggcg
aacctgccgaggatgttcgacgccggcgtcgccgacagagtcgtcgccgagatccgcaag
gcgttcatgggaagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348519
Entry
4348519           CDS       T01015                                 
Name
(RefSeq) red chlorophyll catabolite reductase
  KO
K13545  red chlorophyll catabolite reductase [EC:1.3.7.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4348519
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.12  red chlorophyll catabolite reductase
     4348519
SSDB
Motif
Pfam: RCC_reductase Fe_bilin_red
Other DBs
NCBI-GeneID: 4348519
NCBI-ProteinID: XP_015614206
UniProt: Q338P6
LinkDB
Position
10:complement(12886330..12888549)
AA seq 329 aa
MLQLRSPPPATSSPSSAVSFPTLAPRLLPLRRRRRGAGSQLGGKTSSAVRASSAAAPGAT
EPEVMVEVAHREVARALASLAEARLGARLLPSAVPPDVAEFRSGGGAGNAVGSLDVRRGA
PGSTIDFMLQSSLHCKVPNGAIDITSLLIFLNASTDAPHFLMEFIQGSPTSIVVLLDLLP
RKDLALHPEYIERYYENTQVDKQREKVEELPQARPYRSRSLFVRSTFSLTAILMSIDCGQ
GGEGTLEEIVRGQLATAARALLQIWLDSCADHTSEMEEGERENMIKRDQIVRSKSIEVDL
TSNLPRMFGPDVADRVIAEIQKAFGVQEA
NT seq 990 nt   +upstreamnt  +downstreamnt
atgctccaactccgctcgccgccgccggcgaccagctcgccgtcctccgccgtctccttc
ccgaccctcgctcctcgcctcctccccctccgccgccgccgccgcggcgcgggttcccag
ctcgggggcaaaacgtcgagcgccgtgcgcgcgtcgtcggcggcggcgccgggcgcgacg
gagccggaggtgatggtggaggtggcgcaccgggaggtggcgcgggcgctcgcgtccctg
gcggaggcgcggctgggcgcgcggctgctcccctccgccgtgccgcccgacgtcgccgag
ttccgcagcggcggcggcgccgggaacgccgtgggctcgctcgacgtgcgccgcggcgcg
ccgggatcgacgattgatttcatgctccagtcctcactacactgcaaagtcccaaatggc
gcaatcgacattacatctcttctcatctttctgaacgcctcgacagatgctccgcatttc
ctcatggaatttatacaaggtagcccaacttcgatcgtggtgcttctggaccttctccca
cggaaagaccttgcgctccatcccgaatacatagagagatactatgagaatactcaggtg
gacaaacagcgtgagaaggtcgaagaattgccgcaggcccgtccataccgatcgcgatcc
ctcttcgtgcgcagcaccttctcactgacagcaatactgatgagcatcgactgtgggcaa
ggaggagagggtaccttggaagagatagtgcgtggtcaactagcaacagctgctagggca
cttcttcaaatttggcttgatagttgtgctgatcatacttcagagatggaagaaggcgag
agagaaaacatgataaagagggaccaaattgtaaggtccaagtcaatcgaggtcgacctg
acttcaaatttgccgaggatgtttggtcccgatgtcgcagaccgagtcatagctgaaatc
cagaaggcctttggggtacaagaggcctag

DBGET integrated database retrieval system