KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277292
Entry
107277292         CDS       T01015                                 
Name
(RefSeq) probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107277292
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     107277292
SSDB
Motif
Pfam: GATase_5 AIRS_C FGAR-AT_N FGAR-AT_linker AIRS
Other DBs
NCBI-GeneID: 107277292
NCBI-ProteinID: XP_015640094
UniProt: B9FM04 A0A8J8XK46
LinkDB
Position
5:250703..256990
AA seq 1415 aa
MASPGEMSVSNPLRFQGFPCNLGKRNGFIAARSSGLRRSQQCFHRHLCWPGVRRASVPNV
RLLPTPGALVSRGLDSSLVHKSDNASEAGVIQLYRIPYLQDSETIELLRQVQAKVSSNIV
GIKTEQCFNIQLDNALASEKLATLQWLLAETYEPDKLQAQSFLEEEVARNPYSVIVEVGP
RMTFSTAFSTNAVSICKSLSLMEVTRLERSRRYLLCLDPGYGPLDESQLNDFTALVHDRM
TECVYPKKLTSFHSDVVPEPVRIVPVIERGREALEEINVKMGLAFDEQDIKYYTHLFRDD
IKRNPTTVELFDIAQSNSEHSRHWFFNGKLVIDGETMPRTLFQLVKSPLKANPDNNSVIG
FNDNSSAIKGYPANQLRPTVPGSTSPLSVMMRELDILFTAETHNFPCAVAPYPGAETGAG
GRIRDTHATGKGSFVVASTAGYCVGNLRIEGAYAPWEDPSFSYLSNLASPLQILIDASDG
ASDYGNKFGEPLIQGFTRNFGTRLLNGERREWLKPIMFSGAIGQIDHAHISKGDPEIGML
VVKIGGPAYRIGMGGGAASSMVSGQNDAELDFNAVQRGDAEMAQKLYRVVRACAEMGESN
PIISIHDQGAGGNCNVVKEIIYPKGAEIDIRSIVVGDHTLSVLEIWGAEYQEQDALLVKP
ESRSLLESLCERERVSMAVIGTINGCGKIVLIDSAAVEHAKLNGLPPPTPVEDLELEKVL
GDMPQKTFEFKRVSVVSEPLDIARGVTIMDALKRVLSLPSVCSKRFLTTKVDRCVTGLVA
QQQTVGPLQLPLADVAVIAQTYTDLTGGACAIGEQPTKGLLNPKAMARLAIGEALTNLVW
AKVSSLSDVKASGNWMYAAKLDGEGADMYDAAVALADCMIQLGIAIDGGKDSLSMAAQCD
GEVVKAPGNLVISAYVTCPDITLTVTPDLKLGKDGVLLHIDLSKGKRRLGGSALAQAFDQ
IGNDCPDIDDVLYLKKAFEAVQELLGERLISAGHDISDGGLIVSVLEMAFAGNCGVKLNI
DSEDSSLLQALFAEELGLLLEVHLKDLSVVKQKLQAGGISANVIGKVTASPDIELVVDGR
LHLKEKTSDLRDIWEETSFQLEGLQRLKSCVRLEKEGLKHRTSPSWSLSFTPKFTDEKLL
TASSKPKVAILREEGSNGDREMAAAFYAAGFEPWDITMSDLLAGKSSLEDYRGIAFVGGF
SYADVLDSAKGWAASIRFNQPLIQQFQNFYNRPDTFSLGVCNGCQLMALLGWVPGSDVGG
SLGSGGDMSQPRFIHNESGRFECRFTSVSIGASPAIMFKGMEGSTMGIWSAHGEGRAFFP
DENVLASVVKSNLAPVRYCDDANNITEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERC
FMMWQYPWSPKDWQLEKSGPSPWLRMFQNAREWCS
NT seq 4248 nt   +upstreamnt  +downstreamnt
atggcatctccgggtgaaatgtcagtaagcaatccattacgcttccaaggctttccttgt
aatctgggaaaaagaaatggtttcattgctgcaaggagttctggactgagaagatctcag
cagtgcttccatagacacctttgttggccaggtgttcgaagagcttcagttcctaatgtc
cgattgctgccaactcctggtgctttggtttccaggggacttgacagttcattggttcac
aaatctgataatgcatcagaagctggagttattcaattatatcgtataccatatcttcaa
gacagtgagacaattgagctgctcaggcaagtgcaagcaaaggtttcttctaatattgtg
ggtataaagaccgaacaatgcttcaacattcaattggataatgcattagcttcagagaag
cttgcaacactgcagtggctcttagcagaaacctatgaacctgataagttacaagcacaa
agctttctggaggaggaagtcgctaggaacccttatagtgtcattgttgaggttggtccc
cggatgactttttcaacagcgttctcaaccaatgccgtctcaatatgtaaatctctctca
ttgatggaagtaactcgcttggagagatcaaggagataccttttatgcttggatcctggc
tatggtccacttgatgaaagccagcttaacgactttactgctttggttcatgatagaatg
acagagtgtgtttatcctaagaagctcacatcatttcattcagatgtagttcctgaacct
gtccgtattgttccagtcattgaaaggggaagagaagctctggaagaaataaatgtgaag
atgggacttgcttttgatgaacaagatatcaagtactatacccacctcttcagagatgac
atcaaacggaacccaaccactgttgaacttttcgacattgcacaatccaacagtgagcac
agcaggcattggttttttaatggaaagcttgtgatagatggagagaccatgccgagaacc
ttgtttcagttagtgaagagtcccctgaaagctaaccccgataataactcagtcatcgga
tttaatgacaactcaagtgcaataaagggatatccagcaaatcagctacgcccaacagtt
ccaggctccacttcaccattatctgttatgatgcgtgagcttgatattttattcacagca
gaaacccataattttccatgtgctgtggcaccttatccaggagctgaaacaggtgcaggt
ggtcgcataagggacacacatgccactggaaagggttcttttgttgttgcttctactgct
ggctattgtgttggtaatctccgaattgaaggtgcatatgcaccctgggaggatccatcc
ttttcatatctgtcgaatttggcctcccctttgcaaattcttattgatgctagcgatggc
gcttctgactatgggaacaagtttggtgaacctctaattcagggatttactagaaatttt
gggacgaggttgcttaatggggaacggcgcgagtggctgaagccaataatgtttagtggg
gcaatcgggcaaattgaccatgcacatatatctaagggggatccagaaattggcatgcta
gttgtgaagattggtggcccagcatacagaattggtatgggtggtggtgctgcctccagc
atggttagtggacaaaatgatgcagagctcgatttcaatgcagtacagcgtggagatgct
gaaatggcacagaaattatatcgtgtggtcagggcatgtgcggaaatgggagagagcaac
cctatcatcagcattcatgaccagggtgctggaggaaactgcaatgtggtgaaggaaata
atctatcctaagggcgctgaaattgatatacgatcaattgttgtcggtgatcatacattg
tctgtcttggagatatggggtgctgagtaccaggaacaagatgcacttctggtgaagcct
gagagcagaagccttttagagtcactttgtgaaagggaaagggtttcaatggctgtcatt
gggacaatcaatggatgtggaaagattgttttgattgacagtgctgctgtggagcatgcg
aagttaaatggccttcctcctccaacccctgttgaggatctcgagcttgaaaaggttcta
ggagatatgccccaaaagacctttgaattcaagcgagtctctgtagtcagtgagccctta
gatattgcccgtggagtaacaatcatggatgctctgaagcgagtattgagtcttccatct
gtatgctctaagcgtttcttaaccacaaaagttgacaggtgtgtgacaggtcttgttgca
caacagcagacagttggacctctccaacttcctcttgcagatgtggctgtgatcgcacag
acatacactgatctaacaggtggtgcctgtgccattggagaacagccaacgaaaggttta
cttaatcccaaggccatggcaagacttgctattggggaagccttgactaatctggtttgg
gctaaagtttcatcactttctgatgtcaaagcaagtggtaactggatgtatgctgcaaag
cttgatggagaaggtgcagatatgtatgatgctgctgttgcattggctgactgcatgatt
caacttggtattgcaattgatgggggaaaggacagtctttccatggcagctcaatgtgat
ggtgaggtcgtcaaggctcctggaaatctggtcatcagtgcttatgtgacatgtcctgat
ataacattgacggtaactcctgatttgaagcttggcaaggatggagttttgctgcacatt
gacctcagcaaaggaaagcgccggcttggtggttctgctcttgcacaggcttttgatcaa
attggaaatgactgcccagacattgatgatgtcctgtacttgaagaaagcctttgaggcc
gttcaggaattgcttggtgagcgtcttatttcagctggccatgacattagtgatggaggt
cttattgtgagtgttcttgagatggcatttgctggtaattgcggtgttaagctgaacatt
gactcagaagattctagccttcttcaagcactatttgccgaggagcttggccttctactt
gaagtgcatttgaaagatctgagtgttgtgaaacaaaagcttcaagcaggaggcatttcc
gctaatgtaattggaaaagttacagcatcaccagatattgagctggttgttgatggcagg
ctgcatcttaaggaaaaaacttcagatctcagggatatctgggaggaaacaagcttccag
cttgaggggctacaacgtctgaaatcttgtgtcagacttgagaaagaaggattaaagcac
agaacatcaccatcatggtctttgtctttcactcccaaatttacagatgaaaaactgctg
actgcatcctcaaagccaaaagttgccatccttcgtgaagaagggagcaatggtgatagg
gagatggctgctgcattctatgctgctggattcgaaccatgggatatcacaatgtcagac
ctcttagctgggaagtcttctctagaggattaccgtgggattgcgtttgtcggtggtttt
agctatgcagatgttcttgattcagctaaaggttgggctgcatcaatcaggtttaaccaa
cccctcatacagcagttccagaatttctacaataggccggacactttcagccttggggtg
tgcaatggttgtcagctaatggctcttcttggctgggtaccaggatcagacgttggaggt
tctcttggttcaggtggggacatgtcccagccaagatttattcacaatgaatctggtcgt
tttgagtgccggtttactagtgtctctataggggcctctcctgctatcatgttcaaagga
atggaaggttctacaatgggcatttggagtgctcacggtgaggggagagctttcttccca
gatgaaaatgttctagctagtgttgtaaagtctaacctggctcctgtgcggtactgtgac
gatgctaataacataactgaagtctacccattcaatcccaatggctctccacttggcatt
gcagccctttgctcccctgatggaagacatcttgctatgatgccacacccagagcgttgc
ttcatgatgtggcaatatccatggtctcccaaggattggcagcttgagaagagtggtccc
agcccctggctgcgcatgttccagaatgctagagaatggtgttcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324899
Entry
4324899           CDS       T01015                                 
Name
(RefSeq) probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial isoform X1
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4324899
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     4324899
SSDB
Motif
Pfam: GATase_5 AIRS_C FGAR-AT_N FGAR-AT_linker AIRS
Other DBs
NCBI-GeneID: 4324899
NCBI-ProteinID: XP_015617627
UniProt: Q5N8R3
LinkDB
Position
1:complement(38618736..38625082)
AA seq 1419 aa
MVSPGEMSVSNPLRFQGFPCNVGKRNVFIAARSSGLGRSRIAQQCFQQHHICYPGVRRAS
VPNVRMLPAPGALVSRGVDSSLVPKTGNASEAGVIQLYRIPYLQESETIELLRQVQAKVS
SNIVGIKTEQCFNIQLDNALTPEKLATLQWLLAETYEPDKLQAQSFLEEEISRSPYSVIV
EVGPRMTFSTAFSTNAVSICKSLSLMEVTRLERSRRYLLCLDPGNGPLDESQLNDFAALV
HDRMTECVYPNKLTSFHSDVVPEPVRIVPVIERGREALEEINVKMGLAFDEQDIKYYTHL
FRDDIKRNPTTVELFDIAQSNSEHSRHWFFNGKLVIDGETMPKTLFQLVKSPLKANPDNN
SVIGFKDNSSAIKGYPANQLRPTIPGSTSPLSVMMRELDILFTAETHNFPCAVAPYPGAE
TGAGGRIRDTHATGKGSFVVASTAGYCVGNLRMEGSYAPWEDPSFSYPSNLASPLQILVD
ASDGASDYGNKFGEPLIQGFTRNFGMRLLNGERREWLKPIMFSGAIGQIDHAHISKGDPE
IGMLVVKIGGPAYRIGMGGGAASSMVSGQNDAELDFNAVQRGDAEMAQKLYRVVRACAEM
GESNPIISIHDQGAGGNCNVVKEIIYPKGAEIDIRSIVVGDHTLSVLEIWGAEYQEQDAL
LVKPESRSLLESLCERERVSMAVIGTIDGCGKIVLIDSAAMEHAKINGLPPPTPVEDLEL
EKVLGDMPQKTFEFKRVSLVSEPLDIAPGVTIMDALKRVLSLPSICSKRFLTTKVDRCVT
GLVAQQQTVGPLQLPLADVAVIAQTYTDLTGGACAIGEQPAKGLLNPKAMARLAVGEALT
NLVWAKVSSLSDVKASGNWMYAAKLDGEGADMYDAAVALADCMIQLGIAIDGGKDSLSMA
AQCDGEVVKAPGNLVISAYVTCPDITLTVTPDLKLGNDGVLLHIDLGKGKRRLGGSALAQ
AFDQIGNDCPDIDDVPYLKKAFEAVQELLSQRLISAGHDISDGGLIVSVLEMAFAGNCGV
KLNIDSEDSGLLQALFAEELGLLLEVHLKDLSVVKQKLEAGGISANVIGQVTASPDIELV
VDGRLHLKEKTSDLRDIWEETSFQLEGLQRLKSCVRLEKEGLKHRTSPSWSLSFTPKFTD
EKLLTASSKPKVAIIREEGSNGDREMAAAFYAAGFEPWDITMSDLLAGKSSLEEYRGIAF
VGGFSYADVLDSAKGWAASIRFNQPLIQQFQNFYNRPDTFSLGVCNGCQLMALLGWVPGS
DVGSSLGSGGDMSQPRFIHNESGRFECRFTSVSIGTSPAIMFKGMEGSTLGIWSAHGEGR
AFFPDENVLASVVNSNLAPVRYCDDANNITEVYPFNPNGSPLGIAALCSPDGRHLAMMPH
PERCFMMWQYPWYPKEWQLEKCGPSPWLRMFQNAREWCL
NT seq 4260 nt   +upstreamnt  +downstreamnt
atggtatctccgggtgaaatgtcagtaagcaatccattacgcttccaaggctttccttgt
aatgtgggaaaaagaaatgttttcattgctgcaaggagttctggactgggaaggtcgcga
attgctcaacagtgctttcagcaacatcatatttgttatccaggtgttcgaagagcttca
gttcctaatgtccgaatgctgccagctcctggtgctttggtttccaggggggttgacagt
tcattggttcccaaaactggtaatgcatcagaagctggagttattcagttatatcgtata
ccatatcttcaagagagtgaaacaattgagctactcaggcaagttcaagcaaaggtttct
tctaatattgtgggtataaagactgaacaatgcttcaacattcaattggacaatgcatta
actccagagaagcttgcaacacttcagtggctcttagcagaaacctatgaacctgataag
ttacaagcacaaagctttttggaggaggaaatctctaggagcccttatagtgtcattgtt
gaggttggtccccggatgactttttcaacagcgttctcgaccaatgctgtctcaatatgt
aaatctctctcgttgatggaagtaactcgcttggagagatcaaggagataccttttgtgc
ctggatcctggcaatggtccacttgatgaaagccagcttaatgactttgctgctttggtt
catgatagaatgacagagtgtgtttatcctaacaagctcacatcatttcattcagatgta
gttcctgaacctgtccgtattgttccagtcattgaaaggggaagggaagctttggaagaa
ataaatgtgaagatgggacttgcttttgatgaacaagatatcaagtactatacccacctc
ttcagagatgacatcaaaaggaatccaaccactgttgaactttttgatatcgcacaatcc
aatagtgaacacagcaggcattggtttttcaatggaaagcttgtgatagatggagaaacc
atgccgaaaaccttgtttcagttagtgaagagtcccctgaaggccaaccccgataataac
tctgtcatcggattcaaggacaactcaagtgcaataaagggatacccagcaaatcagctg
cgcccaacaattccaggctccacttcaccattatctgttatgatgcgtgagcttgatatt
ttattcacagcagaaacccataattttccatgtgctgtggcaccttacccaggagctgag
acaggtgcaggtggtcgcataagagacacacatgccaccggaaagggttcttttgttgtt
gcttctactgctggctattgtgttggtaatctccgaatggaaggttcatatgcaccctgg
gaggatccatccttttcatatccgtcgaatttggcctcccctttgcaaattctggttgat
gctagcgatggtgcttctgactatgggaataagtttggtgaacctctaattcagggcttt
actagaaattttgggatgaggctgcttaatggggaacggcgtgagtggctgaagccaata
atgtttagtggggcaatcgggcaaatcgatcatgcacacatatctaagggggatccagag
attgggatgctagttgtgaagattggtggcccagcatacagaattggtatgggtggtggt
gctgcctcaagcatggttagtggacagaatgatgcagagctcgatttcaatgcagtgcag
cgtggagatgctgaaatggcacaaaaactatatcgtgtggtcagggcatgtgcagaaatg
ggagagagcaaccccattatcagcattcatgaccagggtgctggaggaaattgcaatgta
gtgaaggaaattatctatcctaagggtgctgaaattgatatacgatcaattgttgtcggt
gatcatacattgtctgtcttggagatatggggtgctgagtaccaggaacaagatgcactt
ctggtgaagcctgagagcagaagcctgttagagtcactttgtgaaagggaaagggtttca
atggctgtcattggtacaattgatggatgtggaaagattgttttgattgacagtgctgct
atggagcatgccaagataaatggccttcctcctccaacccctgttgaggatcttgaactt
gaaaaggttctaggagatatgccccaaaagacctttgaattcaagcgagtgtctctagtc
agcgagcccttagacattgcccctggagtaacaatcatggatgctctgaagcgagtattg
agtcttccgtccatatgttctaagcgtttcttaaccacaaaagttgacaggtgtgtgaca
ggtcttgttgcacaacagcagacagttggacctctccaacttcctctcgcagatgtggct
gtgattgcacagacatatactgacttgacaggtggtgcctgtgccattggagaacaacca
gcaaaaggtttacttaatcccaaggccatggcaagacttgctgttggggaggccttgact
aatctggtctgggctaaagtttcatcactttctgatgtcaaagcaagtggtaactggatg
tatgctgcaaagcttgatggagaaggtgcagatatgtatgatgctgctgttgcattggct
gactgcatgattcaacttggtattgcaatcgatgggggaaaggacagtctttccatggca
gctcaatgtgatggtgaggttgtcaaggctcctggaaatctggtcatcagtgcttatgtg
acatgtcctgatataacattgacagtaactcctgatttgaagcttggcaatgatggagtt
ttgctgcacattgacctgggcaaaggaaagcgcaggcttggtggttctgctcttgcacag
gcttttgatcaaattggaaatgactgcccagacattgatgatgttccctacttaaagaaa
gcttttgaggccgttcaggaattgcttagtcagcgccttatctcagctggccatgacatt
agtgatgggggtcttattgtgagtgttcttgagatggcatttgctggtaattgcggtgtt
aagctgaacattgactcagaagattcgggccttcttcaagcactctttgccgaggagctt
ggccttcttcttgaagtgcacttgaaagatctcagtgttgtgaagcaaaagcttgaagca
ggaggcatttccgctaatgtaattggacaagttacagcatcaccagatattgagctagtt
gttgatggcaggctgcatctcaaggaaaaaacttcagatctcagggatatctgggaggaa
acaagcttccagcttgaggggctacaacgcctgaaatcttgtgtcagacttgagaaagaa
ggactaaagcacagaacatcaccatcgtggtctttgtctttcactcccaaatttacagat
gaaaaactgctgactgcttcctcaaagccaaaagttgccatcattcgtgaagaagggagc
aatggtgatagggagatggctgctgcattctatgctgctggatttgaaccatgggatatc
acaatgtcagacctcttagctgggaagtcttctctagaggagtaccgtgggattgcattt
gttggtggttttagctatgcagatgttcttgattcagctaaagggtgggctgcatcaatc
aggtttaatcagcccctcatacagcagttccagaatttctataataggccagatactttc
agccttggagtgtgcaatggttgtcagctaatggctcttcttggctgggtaccaggatca
gatgtcggaagttctcttggttcaggtggggacatgtcccagccaagatttattcacaat
gaatctggtcgttttgagtgtcggtttacaagtgtctctatagggacctctcctgctatc
atgttcaaaggaatggaaggttctacactgggcatttggagtgctcatggtgaggggaga
gctttcttcccagatgaaaatgttctagctagtgttgtgaactctaacctggctcctgtg
cggtactgtgacgatgctaataacattaccgaagtctacccgttcaatcccaatggctct
ccccttggcattgcagccctttgctcccctgatggaagacatcttgctatgatgccacac
ccagagcgttgcttcatgatgtggcaatatccatggtatcccaaggaatggcagcttgag
aagtgtggtcccagtccctggctgcgcatgttccagaatgccagagaatggtgtttgtag

DBGET integrated database retrieval system