KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277301
Entry
107277301         CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S27-like
  KO
K02978  small subunit ribosomal protein S27e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107277301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107277301
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    107277301
  Archaea
    107277301
SSDB
Motif
Pfam: Ribosomal_S27e YjdM_Zn_Ribbon Prok-RING_1
Other DBs
NCBI-GeneID: 107277301
NCBI-ProteinID: XP_015636850
UniProt: B9FEZ1
LinkDB
Position
4:19712666..19716872
AA seq 86 aa
MVLSNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVVCPG
CQTVLCQPTGGKARLTEGCSFRRKND
NT seq 261 nt   +upstreamnt  +downstreamnt
atggtgctctccaacgacatcgacctgctgaacccgcccgcggagctggagaagctcaag
cacaagaagaagcgcctcgtccagtcccccaactccttcttcatggatgtcaagtgccag
ggctgcttcagcatcactactgtgttcagccactcccagacagtggtggtctgcccgggc
tgccaaaccgtgctttgccagcctacaggtggaaaggccaggctaacggaggggtgctcc
ttccgccgcaagaatgattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329362
Entry
4329362           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S27
  KO
K02978  small subunit ribosomal protein S27e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329362
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4329362
  Archaea
    4329362
SSDB
Motif
Pfam: Ribosomal_S27e Prok-RING_1
Other DBs
NCBI-GeneID: 4329362
NCBI-ProteinID: XP_015623079
UniProt: Q0E177
LinkDB
Position
2:16445650..16447358
AA seq 86 aa
MVLSNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG
CQTVLCQPTGGKARLTEGCSFRRKGD
NT seq 261 nt   +upstreamnt  +downstreamnt
atggtgctatccaacgacatcgacctcctcaaccctcccgcggagctcgagaagctcaag
cacaagaagaagcgcctcgtgcagtcccccaactcattcttcatggatgtcaagtgccag
ggatgcttcaacataacaaccgtgttcagccactcccagactgttgttgtgtgcccaggc
tgccaaacggtgctctgccagcccacaggagggaaggccaggctcaccgagggctgctcc
ttccgccggaagggcgactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335531
Entry
4335531           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S27
  KO
K02978  small subunit ribosomal protein S27e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4335531
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4335531
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4335531
  Archaea
    4335531
SSDB
Motif
Pfam: Ribosomal_S27e Prok-RING_1
Other DBs
NCBI-GeneID: 4335531
NCBI-ProteinID: XP_015636602
UniProt: A3ASL5 Q7XVZ0
LinkDB
Position
4:16457857..16459548
AA seq 86 aa
MVLSNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG
CQTVLCQPTGGKARLTEGCSFRRKSD
NT seq 261 nt   +upstreamnt  +downstreamnt
atggtgctctcgaacgacatcgacctgcttaacccgccggcggagctggagaagctcaag
cacaagaagaagcgcctcgtccagtcccccaactccttcttcatggatgtcaagtgccag
ggctgcttcaacataacgactgtattcagccactcccagaccgtggttgtgtgcccgggc
tgccagaccgtgctctgccagcctactggtgggaaggccaggctcacggagggctgctcc
ttccgccggaagagcgactag

DBGET integrated database retrieval system