KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277317
Entry
107277317         CDS       T01015                                 
Name
(RefSeq) ubiquitin-60S ribosomal protein L40-like
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107277317
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107277317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107277317
   04121 Ubiquitin system [BR:osa04121]
    107277317
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    107277317
  Archaea
    107277317
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   107277317
SSDB
Motif
Pfam: Ribosomal_L40e ubiquitin Rad60-SLD Ubiquitin_2 DUF2604
Other DBs
NCBI-GeneID: 107277317
NCBI-ProteinID: XP_015647252
LinkDB
Position
7:18350939..18410530
AA seq 135 aa
MQIFVRTLDECITLEVEGSDTIGDVKVKIHDKNGIPADDQRLMHAGRQLDDRRTLADYGI
QKESTLHLAVRLRGGSRGHYPCLAPGLLALARKYIEMKMICRKCYARLPPRSTNCRKKKC
GHSNKLRRKKKLKDY
NT seq 408 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaggacgctggacgagtgcatcacgctggaggtcgagggcagcgac
accatcggcgacgtcaaggtcaagatccacgacaagaacggcatcccggcggacgaccag
cggctgatgcacgccgggaggcagctggatgatcgacggacgctggccgactacggcatc
cagaaggagtccacgctccacctcgccgtccgcctccgcggcggcagccgcggccactat
ccctgcctcgctcccggcctcctcgccctcgcgcgcaagtacatcgagatgaagatgatc
tgccgcaagtgctatgcacgccttccccccaggtctacaaactgccgcaagaagaagtgt
ggtcacagcaacaagctaaggcgtaagaaaaagttaaaggactactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277614
Entry
107277614         CDS       T01015                                 
Name
(RefSeq) ubiquitin-like
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107277614
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107277614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107277614
   04121 Ubiquitin system [BR:osa04121]
    107277614
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107277614
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    107277614
  Archaea
    107277614
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   107277614
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107277614
  Exosomal proteins of colorectal cancer cells
   107277614
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ribosomal_S27 Ubiquitin_2
Other DBs
NCBI-GeneID: 107277614
NCBI-ProteinID: XP_015614163
UniProt: A0A8J8YEW6 Q9FWV0
LinkDB
Position
10:complement(18666276..18667110)
AA seq 147 aa
MSTVMTQIFVKGLTGKTTALRMEPSDTVESVKVKLVDKEGLPPDQQPLIFQGHQLDDGHT
LIYYGIQEESTLHLLGRICGGGGGNKKRKKKAYATPKKGKHEHRKEELAVLRHYRVDDVM
GKVERLRLMCPNPECKDVGALMAKHHD
NT seq 444 nt   +upstreamnt  +downstreamnt
atgtcgacggtgatgacgcagatatttgtgaaagggctgacagggaagacgacggctctg
aggatggagccgtcggatacggtggagagcgtgaaggtgaagctcgtggacaaggagggg
cttccgccagaccagcagccgctcatcttccaggggcatcagctggacgacggccacacg
ctaatctactatggtattcaggaggagtcgacgctgcacctcctcggtcgcatctgtggt
ggcggcggcggcaacaagaagcgaaagaagaaggcgtacgcgacacctaagaagggaaag
catgagcaccgcaaggaagagcttgcggtgctccgtcactatcgtgtcgatgacgtgatg
gggaaggtggagaggctacgactgatgtgtcctaacccagagtgcaaagacgttggcgca
cttatggcgaagcaccacgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326977
Entry
4326977           CDS       T01015                                 
Name
(RefSeq) ubiquitin-40S ribosomal protein S27a-1
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326977
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4326977
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326977
   04121 Ubiquitin system [BR:osa04121]
    4326977
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326977
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4326977
  Archaea
    4326977
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4326977
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4326977
  Exosomal proteins of colorectal cancer cells
   4326977
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Dsc3_N TBK1_ULD Ubiquitin_5 DUF2604 Ogr_Delta
Other DBs
NCBI-GeneID: 4326977
NCBI-ProteinID: XP_015621791
UniProt: Q9ARZ9
LinkDB
Position
1:complement(12645588..12646421)
AA seq 155 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRK
ECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQQA
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacggggaagacgatcacgctggaggtggagtcctcg
gacaccatcgacaacgtgaaggcgaagatccaggacaaggaggggatcccgcccgaccag
cagcggctcatcttcgccggcaagcagctggaggacgggcgcaccctcgccgactacaac
atccagaaggagtcgaccctccacctggtgctccgcctccgcggcggcgccaagaagcgc
aagaagaagacgtacaccaagcccaagaagcagaagcacaagcacaagaaggtgaagctc
gccgtgctccagttctacaaggtggacgacgccaccggcaaggtcacccgcctccgcaag
gagtgccccaacgccgagtgcggcgccggcaccttcatggccaaccacttcgaccgccac
tactgcggtaagtgcggcctcacctacgtctacaaccagcaggcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328390
Entry
4328390           CDS       T01015                                 
Name
(RefSeq) polyubiquitin
  KO
K08770  ubiquitin C
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4328390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4328390
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4328390
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Dsc3_N Ubiquitin_5 DUF2604
Other DBs
NCBI-GeneID: 4328390
NCBI-ProteinID: XP_015624714
UniProt: Q6H7T6 B9F359
LinkDB
Position
2:complement(3340424..3343136)
AA seq 457 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagacattgaccggcaagactatcaccctcgaggtggagtcctct
gacaccatcgataatgtcaaggctaagatccaagataaggagggcatccccccggaccag
cagcgtctcatcttcgctggcaagcagctggaggatggcaggacccttgctgactacaac
atccagaaggagtcgacccttcaccttgtcctccgcctccgtggtggcatgcagatcttt
gtcaagactctgaccggcaagactatcacccttgaggtggagtcttctgacaccatcgac
aacgtcaaggccaagatccaggacaaagagggcatccccccagaccagcagcgtctcatc
ttcgccggcaagcagctggaggatggcaggacccttgctgactacaacatccagaaggag
tccaccctccaccttgtcctccgcctccgtggtggcatgcagatctttgtcaagacactg
accggcaagaccatcaccctcgaggtggaatcttctgacaccatcgacaacgtcaaggcc
aagatccaggacaaggagggcattcccccggaccagcagcgtctcatctttgccggcaag
cagcttgaggacggcaggacccttgctgactacaacatccagaaggagtcaacgcttcac
cttgtcctccgtctcaggggaggcatgcaaatcttcgtgaagactctgaccggcaagacc
atcaccctcgaggtggagtcttctgataccatcgacaatgtcaaggccaagatccaggac
aaggagggcattcccccggaccagcagcgcctcatctttgctggcaagcagctggaggat
ggcaggacccttgctgactacaacatccagaaggagtccaccctccaccttgtgctccgc
cttcgtggtggtatgcagatctttgtcaagaccctcacaggcaagaccatcaccctggag
gttgagagctcggacaccatcgacaacgtcaaggccaagatccaggacaaggagggcatc
cccccagaccagcagcgtctcatcttcgccggcaagcagctcgaggatggccgcaccctc
gccgactacaacatccagaaggagtctaccctccacctggtgcttcgtctccgtggtggt
atgcagatcttcgtgaagaccttgactgggaagaccatcactttggaggttgagagctcc
gacaccattgataatgtgaaggccaagatccaggacaaggaggggattcccccagaccag
cagcgtctgatcttcgctggcaagcagctggaggatggacgcaccctcgccgactacaac
atccagaaggagtccaccctccacctggtgctccgcctccgtggtggtcagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332169
Entry
4332169           CDS       T01015                                 
Name
(RefSeq) ubiquitin-60S ribosomal protein L40-2
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332169
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4332169
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332169
   04121 Ubiquitin system [BR:osa04121]
    4332169
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4332169
  Archaea
    4332169
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4332169
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 zf-C4pol Ubiquitin_5 Dsc3_N DUF2604
Other DBs
NCBI-GeneID: 4332169
NCBI-ProteinID: XP_015629795
UniProt: P0CH34 P0CH35
LinkDB
Position
3:complement(7102156..7104769)
AA seq 129 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGIIEPSLQALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQ
LRPKKKIKN
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcaaatcttcgtgaagaccctgactgggaagaccatcaccctcgaggtggagagcagc
gacaccatcgacaatgtcaaggctaagatccaggacaaggagggaatcccgccggaccag
cagcggctgatcttcgccgggaagcagctggaggacggacgcaccctggctgactacaac
atccagaaggagtccaccctccacctcgtcctcaggctccgtggcggtatcatcgagccg
tcgcttcaggcgcttgcccgcaagtacaaccaggacaagatgatctgccgcaaatgctat
gcgcgcctgcaccctagggctgtcaactgccgcaagaagaagtgtggtcacagcaaccag
ctgaggcccaagaagaagatcaagaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332312
Entry
4332312           CDS       T01015                                 
Name
(RefSeq) ubiquitin
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332312
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4332312
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332312
   04121 Ubiquitin system [BR:osa04121]
    4332312
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4332312
  Archaea
    4332312
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4332312
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 Dsc3_N
Other DBs
NCBI-GeneID: 4332312
NCBI-ProteinID: XP_015630915
UniProt: A0A5S6R6S5
LinkDB
Position
3:8409925..8412096
AA seq 136 aa
MQIFVKTLTGKTITLEVENSDAVANVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGHIWIEPSLRVLAYKHNINKMVCRKCYATLPPRATNCRKKKCGHS
NQLRPKKVRWCRYFNF
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagacgctgacggggaagaccatcaccctcgaggtggagaacagc
gacgccgtcgccaacgtcaaggccaagatccaggacaaggaaggtatcccgccggaccag
cagcgcctcatcttcgccgggaagcagctggaggatggccgcacgctggccgactacaac
atccagaaggagtccacgcttcacctggtgcttcgcctacgcggcggccacatctggatc
gagccctcgctcagggtcctcgcctacaagcacaacatcaacaagatggtctgcaggaag
tgctatgcaactctgcctcccagggctacaaactgccgcaagaagaagtgtggccacagc
aatcagctgaggccaaagaaggtgaggtggtgcaggtacttcaacttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337080
Entry
4337080           CDS       T01015                                 
Name
(RefSeq) polyubiquitin 3
  KO
K08770  ubiquitin C
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4337080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4337080
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4337080
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 Dsc3_N DUF2604
Other DBs
NCBI-GeneID: 4337080
NCBI-ProteinID: XP_015636008
UniProt: Q58G87 A0A7D0I5Z9
LinkDB
Position
4:31962482..31965135
AA seq 381 aa
MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
ADYNIQKESTLHLVLRLRGGL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcagatattcgttaagaccctcactggcaagaccatcaccttggaggttgagttctcc
gatacgattgacaatgtgaaggctaagattcaggacaaggagggcatccctccggaccag
caacgccttatcttcgctggcaagcagcttgaggatgggcgtactctcgcggattataac
atccagaaggagtccaccttgcaccttgtcctccgccttcgtggaggcatgcaaatattc
gtgaagaccctcaccggcaagaccattaccctggaggtcgagtcctccgacacgatcgat
aatgtgaaggccaagatccaggacaaggagggaatcccaccagaccagcagcgtctcatc
tttgctgggaagcagctcgaggatggccgcacccttgcagactacaacatccaaaaggaa
tccaccctgcaccttgtcctgcgcctccggggcggtatgcagatctttgtgaagaccctt
actggcaagacgatcaccttggaggttgagtcctctgacacgatcgacaatgtgaaggcc
aagatccaggacaaggagggtattccaccagaccagcagcggctcatcttcgctggcaag
cagcttgaggacggccgcacccttgctgactataacatccagaaggagtccaccttgcac
ttggtcctccgccttcgtggaggtatgcagatcttcgtgaagaccctcaccggcaagacc
atcaccctggaggttgagtcgtctgacacgatcgacaatgtgaaggccaagatccaggac
aaggagggtattccaccagaccagcagcgcctcatcttcgctggcaagcagcttgaggat
ggtcgcacccttgcagattacaacatccagaaggagtccaccctgcaccttgtcctgcgc
cttcgtggaggtatgcagatcttcgtgaagaccctcactggcaagaccatcactctggag
gttgagtcctctgacaccatcgacaacgtgaaggccaagatccaggataaggagggcatc
cctccagaccagcagcgcctcatcttcgccggcaagcagctcgaggatggccgcaccctt
gccgactataacatccagaaggagtccaccctgcaccttgtcctgcgcctccgtggtggt
ctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337883
Entry
4337883           CDS       T01015                                 
Name
(RefSeq) ubiquitin-40S ribosomal protein S27a-2
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4337883
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4337883
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4337883
   04121 Ubiquitin system [BR:osa04121]
    4337883
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337883
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4337883
  Archaea
    4337883
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4337883
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4337883
  Exosomal proteins of colorectal cancer cells
   4337883
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Dsc3_N Ubiquitin_5 DUF2604
Other DBs
NCBI-GeneID: 4337883
NCBI-ProteinID: XP_015639337
UniProt: P51431
LinkDB
Position
5:3535342..3536114
AA seq 155 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRK
ECPNNDCGAGTFMANHFDRHYCGKCGLTYVYNQKA
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacggggaagaccatcacgctggaggtggagtcctcg
gacaccatcgacaacgtgaaggccaagatccaggacaaggaagggatccccccggaccag
cagcgcctcatcttcgccggcaagcagctcgaggatggccgcaccctcgccgactacaac
atccagaaggagtccaccctccacctcgtgctccgcctccgcggcggcgccaagaagcgc
aagaagaagacgtacaccaagcccaagaagatcaagcacaagcacaagaaggtgaagctc
gccgtgctccagttctacaaggtggacgacgccaccggcaaggtcaccaggctcaggaag
gagtgccccaacaacgactgcggcgcgggcaccttcatggccaaccacttcgatcgccac
tactgcggcaagtgcggcctcacctacgtctacaaccagaaggcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341860
Entry
4341860           CDS       T01015                                 
Name
(RefSeq) polyubiquitin
  KO
K08770  ubiquitin C
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4341860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4341860
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4341860
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Dsc3_N Ubiquitin_5
Other DBs
NCBI-GeneID: 4341860
NCBI-ProteinID: XP_015642957
UniProt: B9FQI7 Q653X6
LinkDB
Position
6:28401671..28404435
AA seq 533 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGQ
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagaccctcaccggcaagaccatcaccctcgaggttgagtcctcg
gacaccattgacaatgtcaaggccaagatccaggacaaggagggcatccccccggaccag
cagcgtctcatctttgctggcaagcagcttgaggatggccgcaccctggccgactacaac
atccagaaggagtccaccctccaccttgtgctcaggctcaggggaggcatgcagatcttc
gtcaagaccttgactggcaagaccatcacccttgaggtcgagtcgtctgacaccattgac
aatgtcaaggccaagatccaggacaaggagggcatccccccggaccagcagcgtctcatc
ttcgctggcaagcagcttgaggatggccgcaccctggccgactacaacatccagaaggag
tctaccctccaccttgtgctcaggctcaggggaggcatgcagatcttcgtcaagaccttg
actggcaagaccatcacccttgaggtcgagtcgtctgacaccattgacaatgtcaaggcc
aagatccaggacaaggagggcatccccccagaccagcagcgtctcatcttcgccggcaag
cagctggaggatggccgcacccttgctgactacaacatccagaaggagtccaccctccac
cttgtgctcaggctcaggggaggtatgcagatcttcgtcaagaccctgaccggcaagacc
atcaccctcgaggtcgagtcctcggacacgatcgacaacgtgaaggccaagatccaggac
aaggagggcatccccccggaccagcagcgtctcatcttcgccggcaagcagctggaggac
ggccgcacccttgccgactacaacatccagaaggaatccaccctccaccttgtgcttagg
ctcaggggaggtatgcagatcttcgtcaagaccctgactggcaagaccatcacacttgag
gtcgagtcctcggacacgatcgacaatgtgaaggccaagatccaggacaaggagggcatc
cccccggaccagcagcgtctcatcttcgctggcaagcagctggaggacggccgcaccctt
gccgactacaacatccagaaggagtccaccctccaccttgtgctcaggctcaggggtggt
atgcagatcttcgtcaagaccctgaccggcaagaccatcacgcttgaggtcgagtcctcg
gacacgatcgacaacgtgaaggccaagatccaggacaaggagggtatccccccggaccag
cagcgcctcatcttcgccggcaagcagctggaggatggccgcaccttggctgactacaac
atccagaaggagtccacccttcacctggttctcaggctcaggggtgggatgcagatcttc
gtgaagaccctgactggcaagaccattacccttgaggttgagtcgtccgacactattgac
aacgtgaaggcgaagatccaggacaaggagggcatccccccggaccagcagcgtctgatc
tttgctggtaagcagcttgaggatggccgcacccttgcggattacaacatccagaaggag
tccacactccacctggtgctccgcctccgtggtggccagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343261
Entry
4343261           CDS       T01015                                 
Name
(RefSeq) ubiquitin
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343261
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4343261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343261
   04121 Ubiquitin system [BR:osa04121]
    4343261
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4343261
  Archaea
    4343261
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4343261
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 CFAP298 Dsc3_N DUF2604
Other DBs
NCBI-GeneID: 4343261
NCBI-ProteinID: XP_015646154
UniProt: A3BJV9
LinkDB
Position
7:complement(18133357..18135395)
AA seq 139 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGGRPGYPMIEPNLLALARSKMEKKMICRKCYARLPYKATNCRKKK
CGHTNELRPKKKLVSKLSV
NT seq 420 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacggggaagaccatcaccctcgaggtcgagagcagc
gacaccatcgacaatgtcaaggccaagatccaggacaaggaagggatcccgccggaccag
cagcggctgatcttcgccgggaagcagctggaggacggccggacgctggccgactacaac
atccagaaggagtcgacgctgcacctcgtgcttcgcctccgcggcggcggccgcccgggc
tacccgatgatcgagcccaacctcctcgccctcgcccgcagcaagatggagaagaagatg
atctgccgcaagtgctacgcgcgccttccctacaaggctaccaactgtcgcaagaagaaa
tgcggccacaccaacgagctgaggccaaagaagaagctggtatccaagctttctgtttga

DBGET integrated database retrieval system