KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277365
Entry
107277365         CDS       T01015                                 
Name
(RefSeq) fructose-bisphosphate aldolase cytoplasmic isozyme-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107277365
   00030 Pentose phosphate pathway
    107277365
   00051 Fructose and mannose metabolism
    107277365
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107277365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107277365
   03036 Chromosome and associated proteins [BR:osa03036]
    107277365
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107277365
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     107277365
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107277365
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    107277365
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   107277365
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 107277365
NCBI-ProteinID: XP_015613786
UniProt: Q10A30 A0A345YV68
LinkDB
Position
10:complement(4343582..4345578)
AA seq 358 aa
MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRAFRELLF
CTPGALQYISGVILFDETLYQKTKDGKPFVDVLKEAGALPGIKVDKGTIEVAGTDKETTT
QGHDDLGKQCAKYYEAGARFAKWRAVLKIGPNQPSQLAIDLNAQGLACYAIICQENGLVP
IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAKKVAP
EVIAEYTVRTLQRTVPPAVPAIVFLSGGQSEEEATLNLNAMNKLSAKKPWSLSFSFGRAL
QQSTLKAWAGKTENVEKARAAFLVRCKANSEATLGTYKGDAVLGEGAAESLHVKDYKY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtcggcctactgcggcaagtacaaagatgagctcataaagaatgctgcctacattggc
accccgggcaagggtatcctcgctgcggacgagtccactggcaccatcggcaagcgcttc
gccagcatcaatgttgagaacgtcgaggataaccgccgtgccttccgcgagctcctcttc
tgcacccctggcgccctccagtacatcagcggcgtgatcctcttcgacgagaccctctac
cagaagaccaaggatggcaagcccttcgtcgatgtcctcaaggaggccggtgccctcccc
ggcatcaaggtggacaagggcaccatcgaggtcgccggcaccgacaaggagaccaccacc
cagggccacgatgacctcggcaagcaatgcgccaagtactacgaggccggtgcccgcttc
gccaagtggcgtgccgtcctcaagatcggacccaaccagccctcccagcttgccattgat
ctgaacgcccagggccttgcttgctacgccatcatctgccaggagaacgggctggtgccg
atcgtcgagccggagatcctcgtcgatggccctcacgacatcgatcgatgcgcgtacgtc
tccgaggtggtcctcgccgcgtgctacaaggcgctgaacgagcaccatgtcctcctcgag
ggcaccctcctgaagcccaacatggtcaccccgggttccgacgccaagaaggtggcgccg
gaggtcatcgcggagtacaccgtccgcaccctccagaggaccgtccctcctgctgtgccg
gccatcgtcttcctctccggtggacagagcgaggaggaggcgacgctgaacctgaacgcc
atgaacaagctcagcgccaagaagccgtggtcgctgtccttctcctttggccgtgccctg
cagcagagcacgctcaaggcctgggctggcaagacggagaacgtagagaaggccagggcg
gccttcctcgtcaggtgcaaggccaactccgaggctaccctgggtacttacaagggtgat
gctgtcctcggcgagggcgctgctgaaagcctgcacgtcaaggactacaagtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325027
Entry
4325027           CDS       T01015                                 
Name
(RefSeq) fructose-bisphosphate aldolase cytoplasmic isozyme-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4325027
   00030 Pentose phosphate pathway
    4325027
   00051 Fructose and mannose metabolism
    4325027
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4325027
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4325027
   03036 Chromosome and associated proteins [BR:osa03036]
    4325027
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4325027
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     4325027
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4325027
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4325027
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4325027
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 4325027
NCBI-ProteinID: XP_015613809
UniProt: Q5N725 A0A1L2JKJ5
LinkDB
Position
1:complement(39433393..39435731)
AA seq 358 aa
MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF
TTPGALQHLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTVEVAGTNKETTT
QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLSIDLNAQGLARYAIICQENGLVP
IVEPEILVDGSHDIERCAYVTEKVLAACYKALNEHHVLLEGSLLKPNMVTPGSESKKVSP
QLIAEYTVRALQRTVPAAVPAIVFLSGGQSEEEATVNLNAMNKLSTKKPWALSFSFGRAL
QQSTLKAWGGKTENVVKAQKAFITRCKANSEATLGTYQGDAVLGEGASESLHVKDYKY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtcggcctactgcggcaagtacaaggacgagctcatcaagaatgctgcctacattggc
actcctggcaagggtatccttgctgcagatgagtccactggcaccattggcaagcgcttt
gccagcatcaatgtcgagaacgttgaggagaaccgccgctctctccgcgagctgctcttc
accacccctggtgccctccagcacctaagtggtgtgatcctcttcgaggagaccctgtac
cagaagaccaaggacggcaagcccttcgtcgatgtcctcaaggagggtggtgtcctccct
ggcatcaaggttgacaagggtaccgttgaggttgccggcaccaacaaagagaccaccacc
cagggccacgatgatcttggcaagcgttgcgccaagtactacgaggccggtgcccgcttc
gccaagtggcgtgctgtcctcaagattggccccaacgagccatcgcagctttccattgac
ctgaatgctcagggtcttgctcgctatgccatcatctgccaggagaacgggctggtgccg
attgtcgagcctgagatccttgtcgatggctctcatgacattgagcgctgtgcctatgtc
accgagaaggtcctcgctgcctgctacaaggccctcaacgaacaccatgtcctcctggag
ggttccctcctgaagcccaacatggtcaccccaggatctgaatccaagaaggtttcccct
cagctcatcgccgagtacaccgtccgcgccctccagaggactgtccctgctgccgtgcct
gccattgtcttcctctctggtggacagagcgaggaggaggcgaccgtgaacctcaacgcc
atgaacaagctcagcaccaagaagccgtgggctctgtccttctccttcggccgtgctctc
cagcagagcacgctcaaggcctggggcggcaagacggagaacgtggtgaaggcgcagaag
gccttcatcaccaggtgcaaggccaactctgaggctacccttggtacataccagggtgat
gctgtgctcggcgagggtgcctctgagagccttcacgtcaaggactacaagtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326074
Entry
4326074           CDS       T01015                                 
Name
(RefSeq) probable fructose-bisphosphate aldolase 3, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326074
   00030 Pentose phosphate pathway
    4326074
   00051 Fructose and mannose metabolism
    4326074
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4326074
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4326074
   03036 Chromosome and associated proteins [BR:osa03036]
    4326074
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326074
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     4326074
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4326074
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4326074
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4326074
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 4326074
NCBI-ProteinID: XP_015643260
UniProt: Q94JJ0 A0A0P0UXT2
LinkDB
Position
1:1016035..1019495
AA seq 388 aa
MAMLTAKLTSPPAATTWLPGGGRRSAPPRRATVIRAAAVSYADELVSTAKSVASPGRGIL
AIDESNATCGKRLASIGLDNTEVNRQAYRQLLLTTAGLGEYISGAILFEETLYQSTTDGK
KFVDCLKDQNIMPGIKVDKGLVPLPGSNNESWCQGLDGLASRCAEYYKQGARFAKWRTVV
SIPCGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHAIERTLEVAEKVWSEV
FFYLAQNNVLFEGILLKPSMVTPGAEHKQKATPEAIAKHTLTMLRRRVPPAVPGIMFLSG
GQSEVEATLNLNAMNQEPNPWHVSFSYARALQNSVLKTWQGRPENVEAAQKALLVRAKAN
SLAQLGRYTGEGESDEAKKGMFQKGYTY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggcgatgctgacggccaagctcacctccccccccgccgccaccacctggctccccggc
ggcggccgccgatccgcgccgccccgccgtgctacggtgatccgcgccgccgccgtctcc
tacgccgacgagctcgtctccaccgcgaaatctgttgcttccccagggcgtggtatcctg
gcaattgatgagtcgaatgccacatgcggaaagagattagcatccattggtttggacaac
acagaagttaaccgccaggcttacaggcagcttttactgaccactgctggtcttggtgaa
tatatttctggtgctatcctttttgaggaaactctttatcagtcaaccactgatggtaag
aagtttgttgactgcttgaaggatcagaatatcatgcccggtatcaaggtcgacaagggc
ttggttccattgcctgggtccaacaatgaatcttggtgccaaggcctagatggtttggct
tcaaggtgtgctgagtactacaagcagggggcacgcttcgctaagtggcggactgttgtt
agcatcccttgtggtccctcagcattagcagtcaaggaagcggcatggggacttgctcga
tatgctgccattgctcaggacaatggcttagtgccaattgttgagccagagatccttctt
gatggtgaccatgcgatcgagagaactcttgaagtggcagagaaagtgtggtctgaggta
ttcttctacctggcccaaaacaatgttctttttgagggtatcctgctgaaacccagcatg
gtgacccctggagctgaacacaagcagaaggccactccagaagccattgcgaagcacacc
cttacaatgctgaggaggagagtgccgcctgctgtccctggaatcatgttcctttctggt
gggcaatctgaggtggaggcaaccctgaacctgaacgcgatgaaccaagaaccaaaccca
tggcatgtgtccttctcatacgcccgggctctccagaactcggtgctgaagacatggcag
gggcgccccgagaacgtggaggcagcgcagaaggcactgctggtccgtgccaaggcgaac
tcgctggctcagctcggtcgctacaccggcgagggcgagagcgatgaggccaagaaggga
atgttccagaagggctacacttactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338737
Entry
4338737           CDS       T01015                                 
Name
(RefSeq) fructose-bisphosphate aldolase cytoplasmic isozyme
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338737
   00030 Pentose phosphate pathway
    4338737
   00051 Fructose and mannose metabolism
    4338737
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4338737
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4338737
   03036 Chromosome and associated proteins [BR:osa03036]
    4338737
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338737
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     4338737
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4338737
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4338737
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4338737
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 4338737
NCBI-ProteinID: XP_015639252
UniProt: P17784
LinkDB
Position
5:19606722..19608915
AA seq 358 aa
MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF
CTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTT
QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP
IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAKKVSP
EVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLSTKKPWSLSFSFGRAL
QQSTLKAWSGKAENIEKARAAFLTRCKANSEATLGTYKGDAVLGEGASESLHVKDYKY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtcggcctactgcggcaagtacaaggacgagctcatcaagaacgctgcctacattggc
actcctggcaagggtatccttgctgcggatgagtccactggcaccattggcaagcgcttc
gccagcatcaacgtcgagaacgttgaggagaaccgccgctccctccgcgagctcctcttc
tgcacccctggcgccctccagtacctcagcggcgtgatcctcttcgaggagaccctgtac
cagaagaccaaggatggcaagcccttcgtcgatgtcctcaaggagggtggtgtcctcccg
ggcatcaaggtggacaagggcacaatcgaggttgccggcaccgagaaggagaccaccacc
cagggccatgatgaccttggcaagagatgcgccaagtactacgaggctggtgcccgcttc
gccaagtggcgcgccgtcctcaagatcggccccaacgagccgtcgcagctcgccattgat
ctgaatgcgcagggcctcgctcgctacgccatcatctgccaggagaacgggctggtgccg
atcgtcgagcccgagatccttgttgatggccctcacgacatcgaccgctgcgcctacgtc
tcggaggtggtcctcgctgcgtgctacaaggccctcaacgagcaccatgtcctcctcgag
ggtaccctcctcaagcccaacatggtcaccccaggctctgacgccaagaaggtgtctccc
gaggtcatcgctgagtacaccgtccgcaccctccagaggaccgtccccgctgccgtgccc
gccatcgtcttcctgtccggtgggcagagcgaggaggaggcgaccctgaacctcaacgcc
atgaacaagctcagcaccaagaagccgtggtcgctgtccttctccttcggccgtgccctc
cagcagagcacgctcaaggcctggtccggcaaggcggagaacattgagaaggccagggcg
gccttccttaccaggtgcaaggccaactccgaggctaccctcggtacatacaagggtgac
gctgtcctcggcgagggcgcctccgagagccttcacgtcaaggactacaagtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341496
Entry
4341496           CDS       T01015                                 
Name
(RefSeq) fructose-bisphosphate aldolase, cytoplasmic isozyme 1
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4341496
   00030 Pentose phosphate pathway
    4341496
   00051 Fructose and mannose metabolism
    4341496
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4341496
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341496
   03036 Chromosome and associated proteins [BR:osa03036]
    4341496
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341496
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     4341496
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4341496
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4341496
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4341496
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 4341496
NCBI-ProteinID: XP_015643164
UniProt: A0A0P0WYX8 Q69V57
LinkDB
Position
6:24227141..24229229
AA seq 358 aa
MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVEPNRQALRELLF
TTPGAFQYLSGVILFEETLYQSTAAGTPFVDVLKAGGVVPGIKVDKGTVDIAGTNGETTT
QGLDSLGARCAKYYEAGARFAKWRAVLKIGAAGEPSELAVKQNAEGLARYALICQENGLV
PIVEPEILTDGAHDIKTCAAVTERVLAAVYKSLNDHKVLLEGTLLKPNMVTPGSDSPKVG
AEVIGEYTVAALRRTVPPAVPGIVFLSGGQSEEEASQNLNAMNKLEVLKPWTLTFSFGRA
LQQSTIKKWGGKKENVAAAQAAFLARCKANSEATLGKYGGAAGDAATSESLYVKGYTY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtctgcctttgtgggaaaatacgcagatgagctgatcaagacggccaagtacatcgcg
acgccggggaagggcatcctcgccgccgacgagtcgacgggcaccatcggcaagcgcctg
gccagcatcaacgtggagaacgtggagcccaaccgccaggcgctccgggagctcctcttc
acgacgcccggcgcgttccagtacctctccggcgtcatcctcttcgaggagacgctctac
cagagcacggccgccggcacgccgttcgtcgacgtgctcaaggccggcggcgtcgtgccg
gggatcaaggtggacaagggcaccgtggacatcgccggcaccaacggcgagaccaccacc
cagggcctcgactccctgggcgcgcgctgcgccaagtactacgaggccggcgcccgcttc
gccaagtggcgggccgtgctcaagatcggcgccgccggcgagccgtccgagctcgccgtc
aagcagaacgccgagggcctcgcccggtacgcgctcatctgccaggagaacggcctcgtc
cccatcgtcgagcccgagatcctcaccgacggcgcccacgacatcaagacctgcgccgcc
gtcaccgagcgcgtcctcgccgccgtctacaagtctctcaacgaccacaaggtcctcctc
gagggcaccctcctcaagcccaacatggtcacccctggctccgacagcccaaaggttggc
gcggaggtgataggggagtacacggtggcggcgctgcggcgcacggtgccaccggcggtg
cccgggatagtgttcctctccggcgggcagagcgaggaggaggcgtcgcagaacctgaac
gccatgaacaagctggaggtgctcaagccatggacgctcaccttctccttcggccgtgcc
ctgcagcagagcaccatcaagaagtggggcggcaagaaggagaacgtcgccgccgctcag
gctgccttcctcgcccggtgcaaggccaactccgaggccacgctcggcaagtacggcggc
gccgccggcgacgccgccacgtccgagagcttgtacgtcaagggctacacctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344545
Entry
4344545           CDS       T01015                                 
Name
(RefSeq) fructose-bisphosphate aldolase cytoplasmic isozyme-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4344545
   00030 Pentose phosphate pathway
    4344545
   00051 Fructose and mannose metabolism
    4344545
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4344545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4344545
   03036 Chromosome and associated proteins [BR:osa03036]
    4344545
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4344545
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     4344545
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4344545
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4344545
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4344545
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 4344545
NCBI-ProteinID: XP_015649702
UniProt: Q6YPF1 A3BP52
LinkDB
Position
8:complement(1127882..1129629)
AA seq 362 aa
MSAYCGKYKDELIRNAAYIGTPGKGILAADESTGTIGKRLASIGVENVEENRRALRELLF
TAPGALDCLSGVILFEETLYQSTRDGTPFVDVLAAAGVLAGIKVDKGTVELAGTDRETTT
QGHDGLGERCRRYYAAGARFAKWRAVLSIGRASSRPSQLAVDANAQGLARYAIICQENGL
VPIVEPEILVDGEHGIEACAEVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDAARA
PPEVVAEHTVRALLRTVPPAVPAIVFLSGGQSEEEATRNLNAMNQVASRGKKPWSLTFSF
GRALQQSTLKAWAGKAENVGKAQAALLARCRANSQATLGAYAGDAAAGEGVSENLHVKDY
KY
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtcggcctactgcggcaagtacaaggatgagttgatcaggaacgcggcgtacattggg
acgccggggaagggcatcctcgccgccgacgagtcgacgggcacgatcgggaagcggctg
gcgagcatcggcgtggagaatgtcgaggagaaccgccgcgcgctccgggagctcctgttc
acggcgcccggcgcgctggactgcctcagcggcgtcatcctgttcgaggagacgctctac
cagagcacccgcgacgggacgccgttcgtcgacgtgctcgccgccgccggcgttctggcc
gggatcaaggtcgacaagggcaccgtcgagctcgccggcaccgaccgcgagacgacgaca
caggggcacgacggcctcggcgagcgctgcaggcggtactacgccgccggcgcgcggttc
gccaagtggcgcgccgtgctcagcatcggcagggcgtcgtccaggccgtcgcagctcgcc
gtcgacgccaacgcgcagggcctcgcgcggtacgccatcatctgccaggagaacgggctg
gtccccatcgtcgagccggagatcctcgtcgacggcgagcacggcatcgaggcttgcgcc
gaggtgacggagcgcgtcctcgccgcgtgctacaaggcgctgagcgaccaccacgtcctc
ctcgagggcaccctcctcaagcccaacatggtgacgccgggctccgacgccgccagggcg
ccgccggaggtggtcgccgagcacaccgtccgcgcgctcctccgcaccgtgccgccggcg
gtgccggccatcgtgttcctgtccggcgggcagagcgaggaggaggcgacgaggaacctg
aacgccatgaaccaggtggcgagcaggggcaagaagccatggtcgctgaccttctccttc
ggccgcgcgctgcagcagagcacgctcaaggcgtgggccggcaaggcggagaacgtcggc
aaggcgcaggcggcgctgctcgcccgctgcagggccaactcccaggcgacgctcggcgcg
tacgccggcgacgccgccgccggcgagggcgtctccgagaacctccacgtcaaggactac
aagtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349897
Entry
4349897           CDS       T01015                                 
Name
(RefSeq) fructose-bisphosphate aldolase, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4349897
   00030 Pentose phosphate pathway
    4349897
   00051 Fructose and mannose metabolism
    4349897
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4349897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349897
   03036 Chromosome and associated proteins [BR:osa03036]
    4349897
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349897
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     4349897
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4349897
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4349897
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349897
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 4349897
NCBI-ProteinID: XP_015616895
UniProt: Q40677 A0A1L2JN36
LinkDB
Position
11:complement(3488636..3491654)
AA seq 388 aa
MASATLLKSSFLPKKSEWGATRQAAAPKPVTVSMVVRAGAYDDELVKTAKTIASPGRGIL
AMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGK
KIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVV
SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAET
FFYMAENNVMFEGILLKPSMVTPGAECKDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSG
GQSEVEATQNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGQPENVKAAQDALLLRAKAN
SLAQLGKYTSDGEAAEAKEGMFVKNYVY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggcgtctgctactctcctcaagtcatctttccttcccaagaagtctgaatggggtgcc
acccgccaggctgccgcccccaagccggtgactgtctccatggttgtccgcgctggtgcc
tacgacgatgagcttgtcaagaccgcgaaaaccattgcatcaccaggaaggggtatcctt
gccatggatgagtcgaacgcgacctgcggtaagaggcttgcgtcaattggccttgagaac
accgaggccaaccgccaggcttaccggaccctccttgtcaccgcaccgggcttgggacag
tacatctccggtgctatcctcttcgaggagactctgtaccagtcaactgtagatggcaag
aagattgtcgacatcctcactgagcagaaaatcgttccaggtatcaaggtcgacaagggt
cttgtgccccttgctggctccaacaacgagtcatggtgccaaggtctcgacggccttgcc
tcgcgcgaggcggcatactaccagcagggcgctcgcttcgccaagtggcgcactgttgtc
agcatccccaacggcccatctgaactcgccgtgaaggaggctgcctggggccttgcccgc
tacgccgccatttctcaggacaacgggctggtgccgattgtcgagcctgagatcctcctc
gacggtgagcatggcatcgacaggaccttcgaggtggcgcagaaggtgtgggcggagacc
ttcttctacatggccgagaacaatgtgatgttcgagggcatcctcctcaagccaagcatg
gtgacacccggtgccgagtgcaaggacagggccacccctgagcaagtatctgactacacc
ctcaagctcctccacagaaggatcccccctgccgtccccggcatcatgttcttgtcgggt
gggcagtcggaggtggaggcgacgcagaacctgaacgcgatgaaccaggggcccaacccg
tggcacgtgtcgttctcgtacgcgagggcgctgcagaacacgtgcctcaagacgtggggc
gggcagccggagaacgtgaaggcggcgcaggacgcgctgctcctccgcgccaaggccaac
tcgctggcgcagctcggcaagtacaccagcgacggcgaggccgccgaggccaaggagggc
atgttcgtcaagaactacgtctactaa

DBGET integrated database retrieval system