KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277374
Entry
107277374         CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107277374
   01040 Biosynthesis of unsaturated fatty acids
    107277374
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    107277374
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     107277374
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   107277374
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 107277374
NCBI-ProteinID: XP_015621198
LinkDB
Position
1:2721302..2725296
AA seq 241 aa
MTLKPNPSPRRLPPPSRSSAMAADGSVLRRLYFSVYNWVVFIGWAQVSLSMILALLDDGH
EAVYAAIERHLLFAQTAAIMEILHSILGLVRSPVSSTLPQITGRLFITWGILWSFPETHS
HILVTPLIISWSITEVIRYSFFGIKESFGFTPSWLLWLRYSTFIVCYPVGMVSEVGLIYI
AFPFMKASEKYCIGMPNKWNFSFDYFYFSTFLMALYVPVFPYLLRHMVAQRKKALSKAKT
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgacgttaaagccaaacccatctcctcgacgtcttcctcctccatctcgcagctctgca
atggcagcggatggttcagtgctccggaggctctacttctctgtctacaactgggttgtc
ttcatcggatgggctcaggtgtcattgtccatgatcttggcgttgttggatgacgggcat
gaggccgtctatgctgctatcgagcggcatctgctgtttgcacagactgctgccatcatg
gagattcttcattccattctaggattggtgaggtctccagtgtcttctactcttccacaa
attactggaaggttgttcattacctggggcatcttgtggagctttcctgagacgcattct
catattcttgttacccccttgatcataagctggtccatcaccgaggtcatcagatattcc
ttctttggcataaaggaatcatttggatttacaccttcctggctcttatggcttaggtac
agcacctttatagtatgctatcctgttggtatggttagtgaggttggcctaatctatatt
gccttccctttcatgaaggcatctgagaaatactgcattgggatgcccaacaaatggaat
ttctccttcgactacttctatttctctacttttttgatggctttgtacgttccagtattt
ccatacttgttgcgccatatggttgcccagcggaagaaagccttgtcaaaggcaaaaacc
acataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324520
Entry
4324520           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4324520
   01040 Biosynthesis of unsaturated fatty acids
    4324520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324520
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     4324520
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4324520
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 4324520
NCBI-ProteinID: XP_015644207
LinkDB
Position
1:2727783..2731563
AA seq 221 aa
MAADGSMVRRLYLSIYNWVAFIGWAQVLCYMTLALLDKGHEAVYAAIERPLLFTQTAAIL
EILHSIVGLVRSPVSSTLPQITGRLFITWGILWSFPETQSYIFVTSLLICWCIIEVTRYS
FYGMKESFGFTPSWLLWLRYSTFIACFPVGVVSEICLAYTVLPFMKASEKYCLRMPNKWN
FSFNYFYANVFFMAFYVPVVPYLFHHMIAQRKKALSKAKTT
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcagcggatggttcaatggtgcggaggctctacctctctatctacaattgggtcgcc
ttcatcggatgggctcaggtgttgtgctacatgaccttggcattgctggataagggacat
gaggccgtctatgctgccatcgagcgacctctgctgttcacgcagactgctgccatcttg
gagattcttcattccattgtagggttggtgaggtctccagtgtcttctactctcccacaa
attactggaaggttgttcattacctggggcatcttgtggagcttccctgagacacagtct
tatatttttgttacctccttgctcatatgctggtgcatcattgaggttaccagatattct
ttctatggcatgaaggagtcatttggatttacaccttcctggctcttatggcttaggtac
agcaccttcatagcatgctttcctgttggtgtggttagtgagatttgcctagcctacact
gttcttcctttcatgaaggcgtctgagaaatactgccttaggatgcccaacaaatggaat
ttctccttcaactacttctatgccaatgtctttttcatggctttttatgtcccagtggtt
ccatacttgtttcaccatatgatcgcccagcggaagaaggccttgtcaaaggcaaaaacc
acataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324521
Entry
4324521           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4324521
   01040 Biosynthesis of unsaturated fatty acids
    4324521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324521
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     4324521
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4324521
SSDB
Motif
Pfam: PTPLA DUF2523 Phenol_monoox
Other DBs
NCBI-GeneID: 4324521
NCBI-ProteinID: XP_015645941
UniProt: Q5ZEI3 A0A0P0UYF0
LinkDB
Position
1:2741454..2747429
AA seq 225 aa
MPEEAAGMASVLRRLYLSVYNWIVFIGWVQVSWSMILALLEKRYEAVYAAVEQHLLFAQT
AAIMEILHSIVGLVRSPVSSTLPQITARLFMIWGILRSFPEIHTHIFVTSLLISWCITEV
TRYSFNGMKESFGFTPSWLLWLRYSTFIVCFPIGMVSEVGLVYIVVPFMKASEKYCLRMP
NKWNFSIKYFYASVFFMALYAPVYPHLFHYLIVQRKKALAKSKTT
NT seq 678 nt   +upstreamnt  +downstreamnt
atgcccgaagaagctgctgggatggcgtcagtcttgcggaggctctacctctctgtctac
aactggattgtcttcatcggatgggttcaggtgtcgtggtccatgatattggcattgttg
gagaagagatatgaggccgtctacgctgctgtagagcagcatctgctgttcgcgcagact
gctgccatcatggagattcttcattccattgtagggttggtgaggtctccagtgtcttct
actcttccacaaattactgcaaggttgttcatgatctggggcatcttgcggagcttccct
gagatacacactcatatttttgttacctccttgctcataagctggtgcatcactgaggtt
accagatattctttcaatggcatgaaggagtcatttggatttacaccttcctggctctta
tggcttaggtacagcaccttcatagtatgctttcctattggtatggttagtgaggttggc
ctagtctacattgttgttcctttcatgaaggcatctgagaaatactgccttaggatgccc
aacaaatggaatttctccatcaaatacttctatgcctctgtctttttcatggctttgtat
gccccagtatacccgcacttgttccactatttgatcgtccagcggaagaaggccttggca
aaatcaaaaaccacataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324522
Entry
4324522           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4324522
   01040 Biosynthesis of unsaturated fatty acids
    4324522
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324522
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     4324522
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4324522
SSDB
Motif
Pfam: PTPLA Phenol_monoox
Other DBs
NCBI-GeneID: 4324522
NCBI-ProteinID: XP_015624901
LinkDB
Position
1:2752062..2761619
AA seq 254 aa
MLVHLGGVEYPGQSHQPSRRFLPSRIFPAMAGNASGVRRLYLSLYNWIVFIGWVQVSWFM
ILALLKNGYEAVYAAVEQHLLFAQTAAIMEILHSIVGLVRSPVPSTVLQVTGRLFMIWGI
LWSFPETHSHILVTSLIICWCITEVTRYSFHGMKESFGFTPSWLFWLRYSTFIVCFPVGM
VCEVVLIYIALPFMEMKAQQYQASEKSDKWSFSFNYFYANLFFMASFATVYPVLFRYLIA
LRKKALAKAKPHNY
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcttgtacatcttggaggagtagagtatcccggtcaaagccatcagccatctcgacgt
tttcttccatctcgcatatttcctgcaatggcagggaatgcgtcaggggtgcggaggctc
tacctctctctctacaactggattgtcttcatcggatgggttcaggtgtcgtggttcatg
atattggcattgctgaagaacggatatgaggccgtgtatgctgccgtagagcagcatctg
ctgttcgcgcagactgctgcaatcatggagattcttcattccattgtaggtttggtgagg
tctccagtgccttctactgttctacaagttactggaaggttgttcatgatctggggcatc
ttgtggagcttccctgagacacactctcatatccttgttacctccttgatcatatgctgg
tgcatcactgaggttaccagatattctttccatggcatgaaggagtcatttggatttaca
ccttcctggctcttttggcttaggtacagcaccttcatagtatgctttcctgttggtatg
gtttgtgaggttgtcctaatctacattgctcttcctttcatggagatgaaggctcaacaa
tatcaggcatctgagaaatccgacaaatggagtttctccttcaactacttctatgccaat
ctctttttcatggcttcgtttgccacagtatatccagtcttgtttcgctacttgatcgcc
ctgcggaagaaggccttggcaaaagcaaaaccacataactactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335343
Entry
4335343           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4335343
   01040 Biosynthesis of unsaturated fatty acids
    4335343
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4335343
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     4335343
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4335343
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 4335343
NCBI-ProteinID: XP_015633753
UniProt: Q7XSZ4
LinkDB
Position
4:11335296..11338814
AA seq 221 aa
MAGVGSAVRRLYLSVYNWAVFFGWAQVLYYAVTTLLESGHEAVYAAVERPLQFAQTAAFL
EILHGLVGLVRSPVSATLPQIGSRLFLTWGILWSFPETHSHILVTSLVISWSITEIIRYS
FFGMKEAFGFAPSWLLWLRYSTFMVLYPTGISSEVGLIYIALPYMKASEKYCLRMPNKWN
FSFDFFYASILSLAIYVPGSPHMFTYMLAQRKKALAKAKAA
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcgggcgtcgggtcggcggtgcggcggctctacctctccgtttacaactgggccgtc
ttcttcggatgggcgcaggtgctgtactacgcggtcacgacgctgctggagagcggccat
gaggccgtctacgccgccgtcgagcggccgctgcagttcgcgcagaccgccgccttcttg
gagattcttcatgggcttgtaggtttggtgaggtctccagtctctgcaactcttccacaa
attggatcgaggttgtttcttacctggggcatcctgtggagctttccagagacacattca
catatccttgttacttccttggtcataagctggtccatcactgagatcattagatattcc
ttctttggcatgaaggaggcattcggatttgctccttcctggctcttatggctgaggtat
agcacctttatggtattgtatcctactggtatcagcagtgaggtcggtttaatctacatt
gccttgccttacatgaaggcatcagagaaatactgccttaggatgcccaacaaatggaac
ttctcctttgatttcttctatgcatccatcctttctctcgccatctacgtgcccggatcg
cctcacatgttcacctacatgcttgcccaacggaagaaggcattggcaaaggctaaggct
gcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339019
Entry
4339019           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 isoform X1
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4339019
   01040 Biosynthesis of unsaturated fatty acids
    4339019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4339019
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     4339019
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4339019
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 4339019
NCBI-ProteinID: XP_015637918
UniProt: B9FKL8 Q0DHK0
LinkDB
Position
5:complement(22633142..22636144)
AA seq 219 aa
MARPSQLYLLSYNSVQALGWFVALLRLLPCLAPPSSVHSSYAVAGDLVCLLQTWAILETI
HAAIGLVHTSPLLAFLQWGGRTHFVLAVVRQIPEVQSSPSVFITFMAWSISEVIRYSHYA
LTTLKVCPPWLTYLRYTAFIPLYPIGVGPGEMWTMYQALPFVKERKLYSGFFGKFSMSYH
SFLVAVLAVYPFLWMKLYLHVFKQRRSKLGKSGGAKKRA
NT seq 660 nt   +upstreamnt  +downstreamnt
atggctcgcccgtcgcagctctacctcctctcctacaactccgtccaggccctcggatgg
ttcgtcgccttgctccgcctgctgccctgcctcgcccctccctcctccgtccactcgtca
tacgccgtcgccggcgacctcgtatgcttgctgcagacgtgggcgattcttgaaacgatc
catgccgccatcggattggtgcacacgtcgccgcttcttgccttcttgcagtggggaggg
aggactcacttcgttctcgctgtggttcggcaaatccccgaggttcagagtagcccttcc
gtgttcataacgttcatggcttggagcatatctgaggtcatcagatactcacattatgct
ctgacaaccttaaaagtttgtccaccatggctaacatatctcaggtacactgcctttata
ccgctgtatccaattggagtaggcccaggagaaatgtggactatgtaccaagctctccca
tttgtgaaggagaggaaactctactctggcttctttgggaagttctccatgagctaccat
tccttcctagtggctgtgctggcagtctacccgtttctgtggatgaagctgtacctgcat
gtgttcaagcagcgcaggtcgaagctggggaaatcgggaggcgccaagaaacgagcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272625
Entry
9272625           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    9272625
   01040 Biosynthesis of unsaturated fatty acids
    9272625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    9272625
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     9272625
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   9272625
SSDB
Motif
Pfam: PTPLA DUF5357 Phenol_monoox
Other DBs
NCBI-GeneID: 9272625
NCBI-ProteinID: XP_015649093
LinkDB
Position
8:18675920..18678537
AA seq 252 aa
MLSHIDWWNRVSRSKPLATIPTSSSISHISAMAGNASVMRRLYLSFYNWIVFIGWVQVSW
SMILALLENGYEAVYAAVEQHLLFAQTAAIMEILHSIVGLVRSPVSSTIPQITGRLFMIW
GILWSFPETHTHIFVTSLLISWCITEVTRYCFYGMKESFGFTPSWLLWLRYSTFIVCLPV
GTVSEVGLIYIVLPFMKASGKYCLRMPNKWNFSFNYFYASIFFMVLYAPVYPRLFRYLIA
QRKKALAKAKTT
NT seq 759 nt   +upstreamnt  +downstreamnt
atgctctcgcacatcgattggtggaacagagtatcccggtcaaagccattagccaccatc
ccgacgtcttcctccatctcgcatatctctgcaatggcagggaatgcgtcagtgatgcgg
aggctctacctctctttctacaactggattgtcttcatcggatgggttcaggtgtcgtgg
tccatgatattggcattgttggagaacggatatgaggccgtctatgctgccgtagagcag
catctgctgttcgcgcagactgctgccatcatggagattcttcactccattgtagggttg
gtgaggtctccagtgtcttctactattccacaaatcactggaaggttgttcatgatctgg
ggcatcttgtggagcttccctgagacacacactcatatttttgttacctccttgctcata
agctggtgcatcactgaggttaccagatattgtttctatggcatgaaggagtcatttgga
tttacaccttcctggctcttatggcttaggtacagcaccttcatagtatgccttcctgtt
ggtacggttagtgaggttggcctaatctacattgttcttcctttcatgaaggcatctggg
aaatactgccttaggatgcccaacaaatggaatttctccttcaactacttctatgcctct
atctttttcatggttttgtatgccccagtatatccacgcttgtttcgctacttgatcgcc
cagcggaagaaggccttggcaaaagcaaaaaccacataa

DBGET integrated database retrieval system