KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277381
Entry
107277381         CDS       T01015                                 
Name
(RefSeq) putative 12-oxophytodienoate reductase 13
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    107277381
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     107277381
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 107277381
NCBI-ProteinID: XP_015637023
UniProt: B9FFD3
LinkDB
Position
4:complement(22103120..22106938)
AA seq 376 aa
MDPVPLFNPCEMGRFTFSHRIVLAPLTRARSYGNLPQSHAILYYSQRATKGGLLISEATG
VSSDAPCTNTPGIWTKEQVEAWKPVVDAVHAKGGIFFCQIWHVGRASDLEQEPISSTDKP
VEKNEDMDFPVPRRLAVEEIPDVINHFRIAARNAIDAGFDGVEVHGAHGFLLEQFMKDGV
NDRADEYGGSLQNRCRFALEVIDAVSTEVGPDRVGFRISPYISYYGCHDSDPDALGVYMA
RELDRRGVLYCSAVEPEMVAATTVVDGETTTTTMSRRMMIPHRLHGMREAFRRGMFMVGG
GYDRDAGNMAVASGYADMVVFGRLFLANPDLPRRFQLDAPLNKYDRATFYTHDPVVGYTD
YPFLDDDREAMSDHTG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggatcctgttcctcttttcaatccttgtgaaatgggaagattcactttctcacacaga
attgtgttggcaccattaacaagagcaagatcatatggcaatctcccacaatcacatgcc
atactgtactactcgcaacgggctacaaaagggggacttctgatttcagaagccacaggg
gtgtcgtctgatgctccatgcacaaacacccctgggatatggaccaaggaacaagtagag
gcctggaaacctgtcgtggatgctgtgcatgcaaagggcgggatattcttctgccagatt
tggcatgtaggaagagcatctgacttagagcaagaacccatctcaagcacggacaagcca
gtggaaaagaatgaagacatggatttccctgtcccaagacgcttagctgttgaagaaatt
cctgatgtcatcaatcatttcagaatagctgcaagaaatgctatagatgctgggtttgac
ggggtcgaagttcacggcgcgcatggcttcctcctcgagcagttcatgaaagacggcgtc
aacgaccgcgccgacgagtacgggggcagcctgcagaaccgctgccgcttcgccctcgag
gtcatcgatgccgtgtccaccgaggtcggtcccgaccgcgtcgggttccgcatctcccct
tacatcagctactacggctgccatgactccgacccggacgcgctgggcgtgtacatggcc
cgggagctggacaggcgcggcgtcctgtactgcagcgcggtggagcccgagatggtcgct
gcgacaacagtggtggacggcgagacgacgacgacgacgatgagtaggaggatgatgatc
ccgcataggctgcacggcatgagggaggccttcaggagggggatgttcatggtcggagga
gggtacgacagggatgctgggaacatggccgtggcgtctgggtacgccgacatggtggtg
ttcggtcgcctgttcctggcaaatcctgacctgccgaggaggtttcagctggacgcgccc
ctgaacaagtatgaccgggcaacgttctatacccatgaccctgtggtagggtacacggac
tacccgtttcttgatgatgatcgtgaggcgatgagtgatcacacaggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107279821
Entry
107279821         CDS       T01015                                 
Name
(RefSeq) putative 12-oxophytodienoate reductase 12
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    107279821
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     107279821
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 107279821
NCBI-ProteinID: XP_015620838
LinkDB
Position
Unknown
AA seq 406 aa
MGVFQKGEDQKGESANMKPIPLLSSYDMGKFNLSHRVVLAPLTRSRSYGNLPQSHAMEYY
SQRATKGGLLIAEATGVSSDAQGMSVIPHTPGIWTKEQVEAWKPIVDAVHAKGGIFFCQI
WHVGRASDMEERPISSTDKPIEKTEENYFLGFSTPRSLTVEEIPDVIKHFTLAAKNALEA
GFDGVEVHAANGFLLDQFMKDGVNARADEYGGGVAGRCRFALEVVDAVAAEAGAGRTGVR
LSPYSRCLDCADSDPDALAAHMARELGSRGVLYCNVVEPEMVATPAEGGSGGETMRIPHR
LRAVREAFAGTLMVGGGYDREEGNWAFAGGYADLVVYGRLFLANPDLPRRFRLGAPLNGY
DRATFYTADPVAGYTDYPFLDDDGDDGLAASAASASSNKSGDQDGV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgggtgtctttcaaaagggagaagatcagaaaggagagagtgcaaatatgaagcctata
cctcttctaagttcttatgatatggggaagttcaacttgtcacacagggttgtgctagca
ccactaacaagatctagatcatatggcaatctcccgcaatcacatgccatggaatactac
tcacagagggcaaccaaaggaggccttctaattgctgaagctacaggtgtgtcatctgat
gcacaagggatgagtgtaatccctcacaccccagggatatggaccaaggaacaagtagag
gcatggaagcctattgtagatgcagtgcatgctaagggtggtatatttttctgtcaaatc
tggcatgttggaagagcatcggacatggaggaacggcccatctcaagcacagataaaccc
atagagaagactgaagagaactacttcctgggtttctccaccccaaggagcttaactgtt
gaagagatccctgatgtcatcaagcatttcacacttgctgccaaaaatgccttggaggct
ggttttgatggggttgaggttcacgccgcaaacggcttcctcctggaccagttcatgaag
gacggcgtcaacgcccgcgccgacgagtacggcggcggcgtggcgggccgctgccgcttc
gcgctggaggtggtcgacgccgtggcggcggaggccggggccggccgcaccggcgtccgc
ctctccccgtactcccgctgcctcgactgcgccgactccgacccggacgcgctcgccgcc
cacatggcgcgcgagctgggctcgcgcggcgtcctctactgcaacgtggtggagccggag
atggtggcgacgccggcggagggcggcagcggcggcgagacgatgcggatcccgcaccgg
ctgcgcgccgtgcgggaggcgttcgccggcacgctgatggtcggcggcgggtacgacagg
gaggagggcaactgggccttcgccggcggctacgccgacctcgtcgtctacggccgcctt
ttcctggccaacccggacctcccccggaggttccggctcggcgcgccgctcaacgggtac
gacagggcgacgttctacaccgccgaccccgtcgccggctacaccgactacccgttcctc
gacgacgacggcgacgacggcctcgcggcgtcggcggcgtcggcgagctccaacaagagc
ggcgatcaggacggcgtttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107279822
Entry
107279822         CDS       T01015                                 
Name
(RefSeq) putative 12-oxophytodienoate reductase 13
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    107279822
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     107279822
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 107279822
NCBI-ProteinID: XP_015620839
UniProt: B9FFD3
LinkDB
Position
Unknown
AA seq 376 aa
MDPVPLFNPCEMGRFTFSHRIVLAPLTRARSYGNLPQSHAILYYSQRATKGGLLISEATG
VSSDAPCTNTPGIWTKEQVEAWKPVVDAVHAKGGIFFCQIWHVGRASDLEQEPISSTDKP
VEKNEDMDFPVPRRLAVEEIPDVINHFRIAARNAIDAGFDGVEVHGAHGFLLEQFMKDGV
NDRADEYGGSLQNRCRFALEVIDAVSTEVGPDRVGFRISPYISYYGCHDSDPDALGVYMA
RELDRRGVLYCSAVEPEMVAATTVVDGETTTTTMSRRMMIPHRLHGMREAFRRGMFMVGG
GYDRDAGNMAVASGYADMVVFGRLFLANPDLPRRFQLDAPLNKYDRATFYTHDPVVGYTD
YPFLDDDREAMSDHTG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggatcctgttcctcttttcaatccttgtgaaatgggaagattcactttctcacacaga
attgtgttggcaccattaacaagagcaagatcatatggcaatctcccacaatcacatgcc
atactgtactactcgcaacgggctacaaaagggggacttctgatttcagaagccacaggg
gtgtcgtctgatgctccatgcacaaacacccctgggatatggaccaaggaacaagtagag
gcctggaaacctgtcgtggatgctgtgcatgcaaagggcgggatattcttctgccagatt
tggcatgtaggaagagcatctgacttagagcaagaacccatctcaagcacggacaagcca
gtggaaaagaatgaagacatggatttccctgtcccaagacgcttagctgttgaagaaatt
cctgatgtcatcaatcatttcagaatagctgcaagaaatgctatagatgctgggtttgac
ggggtcgaagttcacggcgcgcatggcttcctcctcgagcagttcatgaaagacggcgtc
aacgaccgcgccgacgagtacgggggcagcctgcagaaccgctgccgcttcgccctcgag
gtcatcgatgccgtgtccaccgaggtcggtcccgaccgcgtcgggttccgcatctcccct
tacatcagctactacggctgccatgactccgacccggacgcgctgggcgtgtacatggcc
cgggagctggacaggcgcggcgtcctgtactgcagcgcggtggagcccgagatggtcgct
gcgacaacagtggtggacggcgagacgacgacgacgacgatgagtaggaggatgatgatc
ccgcataggctgcacggcatgagggaggccttcaggagggggatgttcatggtcggagga
gggtacgacagggatgctgggaacatggccgtggcgtctgggtacgccgacatggtggtg
ttcggtcgcctgttcctggcaaatcctgacctgccgaggaggtttcagctggacgcgccc
ctgaacaagtatgaccgggcaacgttctatacccatgaccctgtggtagggtacacggac
tacccgtttcttgatgatgatcgtgaggcgatgagtgatcacacaggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325705
Entry
4325705           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: putative 12-oxophytodienoate reductase 10
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4325705
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     4325705
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 4325705
NCBI-ProteinID: XP_015623263
LinkDB
Position
1:complement(15185078..15188296)
AA seq 372 aa
MEASTPLLTPYKMGQFDLAHRVVLAPLTRCRSYGNVPGPHNAAYYAQRAARGALLVAEAC
AVSETARGYPDVPGIWSAEQVGAWXVHAKGAVFFCQIWHTGRVSPTEFQPNGQAPISSTD
KQVTPQVSHDGQVLEFAPPRRLKTEEIPNIVDDFRIAARNAIEAGFDGVEIHGANGYLID
QFMKDSVNDRTDAYGGGIENRCRFAAEVITAVAGEIGAHRLGVRLSPFADYMDCHDSDPE
VLALRVIGLMNNLGVLYCHMIEPRMCVGAGEDGSKPVIAHGRLLPFRKAFRGTFMVNGGY
DRDEGDKAVADGYADLVAYGRLFLANPDLPERFRRKAGLNKYDRSTFYTSDPVVGYTDYP
FLDDQNSELATR
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggaggcgtcgacccctcttctgaccccttacaagatgggccagtttgatctcgctcac
agggtcgttcttgcgccgttgacgcggtgccggtcctacgggaacgtgcccgggccgcac
aacgccgcgtactacgcgcagcgggcggcgcggggcgcgctgctggtggcggaagcctgc
gcggtgtcggagacggcgagagggtaccccgacgtgcccgggatttggagcgcggagcag
gtgggggcgtggnncgtgcacgccaagggcgccgtcttcttctgccagatatggcacacg
ggccgcgtctccccgacagagttccagcctaatgggcaagcacccatctcaagcacggac
aagcaagtgaccccacaggtcagccatgatggccaagttctggaattcgctcctcctcga
agactgaaaacagaggagatcccaaacatcgtcgacgactttcgtattgctgccagaaat
gccatcgaggccggtttcgacggggttgagatccacggcgccaatggttacctgatcgac
cagttcatgaaggacagcgtcaacgaccggaccgacgcgtacggcggcggcatagagaac
cggtgccgcttcgccgcggaggtgatcacggcggtggccggcgagatcggcgcgcaccgc
ctgggggtgcgcctctccccgttcgccgactacatggactgccacgactccgacccggag
gtcctcgcgctgcgcgtgatcggcctcatgaacaacctcggcgtcctctactgccacatg
atcgagccgagaatgtgcgtcggcgccggcgaggacggcagcaagccggtgatcgcgcac
ggccgcctgcttccgttcaggaaggcgttccggggcacgttcatggtgaacggtgggtac
gaccgggacgaaggcgacaaggcggtcgccgacggctacgccgacctggtggcgtacggg
cggctgttcctggccaaccctgacctgccggagaggttcaggaggaaggcaggtctgaac
aagtatgacaggagcacgttctatacctctgatcctgtggtgggctacacggactacccg
tttctggatgatcagaattcagaactagcaactcgttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329684
Entry
4329684           CDS       T01015                                 
Name
(RefSeq) putative 12-oxophytodienoate reductase 8 isoform X9
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4329684
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     4329684
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 4329684
NCBI-ProteinID: XP_015627742
UniProt: Q0E0C6
LinkDB
Position
2:complement(21221534..21231370)
AA seq 406 aa
MIRKKASPHCLHDVSGSCPHLSILLHSSRRPESAPVPCLLPMEAKIPLLTPHTMGRFHLA
HRVVHAPLTRSRCYNNLPQEHVQLYYSQRATNGGLLIAEATGVSETAQGYPNTPGIWTKE
QVEAWRTVVDAVHQKGGVFFCQIWHVGRASTNDYQPNGQTPIPCTDKKITPTVLKDGTVE
EFSAPRRLREDEIPQIVDDFRIAARNCIEAGFDGVEIHCAFGYLIEQFMKDGVNDRTDKY
GGSIANRCRFALEVIQAAIDEIGSDRVGVRLSPYSNCLDCWDSDPDALGLYMIQAMSKLG
VLYCSMVEPEVVKVDGKVQIPYKLWHFRKVFAGTFIVAGGYNREEGNRAVSQGYTDLVAY
GKWFLANPDLPRRFELNAPLNKYDRSTFYTSDPVIGYTDYPFLSPL
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgattcgcaaaaaagcctccccacactgcctacatgacgtcagcggttcttgccctcac
ctctcgattcttctccactcgagcagaagaccggaatcagctcccgtaccctgtttgtta
cccatggaagcgaaaattcccctccttactcctcacaccatggggagattccacctcgcc
cacagggttgtccatgcgccgctgaccagatcgaggtgctacaataatcttcctcaagaa
catgttcagctgtactactcgcagagggccacaaatggcggccttctgatcgctgaagcc
accggggtctcggagactgctcaagggtatccaaacacaccgggtatatggacaaaggag
caggtggaagcttggaggacggttgtggatgcagtgcatcagaagggtggtgttttcttc
tgccaaatctggcatgtagggagggcatctaccaatgattatcagcccaatggacaaaca
ccaattccttgtacagacaagaaaatcactcctacagttctcaaagatggaactgtcgag
gaattctctgccccaaggaggctaagagaagatgagatcccccaaattgttgatgatttc
cgaattgctgctaggaattgcattgaagcaggctttgacggagttgaaatccactgcgca
tttgggtacctaattgaacagttcatgaaagatggtgtcaacgacagaactgacaagtac
ggaggaagcatcgcaaaccgttgccgctttgctctagaggtaatccaagcagccatcgat
gagatcggatcggacagagtaggtgtccgtctctcgccatactcaaactgcctggactgt
tgggactcagacccagatgcacttggcctctacatgatccaagccatgagcaagctgggc
gttctctactgcagcatggttgagcctgaggtggtcaaagtagacggcaaggtgcagatt
ccttacaagctatggcacttcaggaaagtgtttgctggcactttcatcgtcgctggagga
tacaacagagaagaaggcaatagagcagtgtctcagggttacacagacctggtagcatat
ggtaaatggttcttggcaaacccggatctgcctaggcggtttgagctgaatgcgcctctg
aacaagtatgacagatcgacgttctacacttctgatccagttatcgggtacaccgattac
ccttttctcagtcctctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340484
Entry
4340484           CDS       T01015                                 
Name
(RefSeq) putative 12-oxophytodienoate reductase 6
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4340484
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     4340484
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 4340484
NCBI-ProteinID: XP_015641952
UniProt: Q69TI2
LinkDB
Position
6:complement(5878559..5880551)
AA seq 391 aa
MVQHHQAAANDDHQAIPLLTPYKQAGRPGSKLDLSHRVLLAPMTRCRSYGNVPQPHAALY
YTQRATRGGLLITEATGVSATAQGYPETPGVRTREHVEAWKPIVDAVHRKGALFICQLWH
VGRVSNNGFQPDGLAPISSTDKAITPDGYGMVYSKPRRLRTDEIPQIVDDFRLAARNAVE
AGFDGVEIHGANGYLLEQFMKDSSNDRTDEYGGSLENRCRFAVEVIDAVVGEIGAHSVGI
RLSPFLDYMDCVDSDPEALGSYMVEQLNKHEDFLYCHMVEPRMAIVDGRRQIQHGLLPFR
KQFNGTFIAAGGYDREEGNKAVADGYADLVAYGRLFLANPDLPKRFELDAPMNNYDRNTF
YTQDPVVGYTDYPFLDEHHHDDDDDSNAPSA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggtgcagcatcatcaagcggcggcgaacgacgatcatcaggctatcccgctgctgaca
ccgtacaagcaggctgggcgcccggggtcgaagcttgacctctcccaccgtgtgctgctc
gcgccgatgacgcggtgccgatcctacggcaacgtgccgcagccgcacgcggcgctgtac
tacacgcagcgcgccacccgcggcggcctcctcatcacggaggccaccggcgtctccgcc
accgcgcagggctacccggagacacccggcgtccggacgcgggagcacgtcgaggcgtgg
aagcccatcgtcgacgccgtccaccgcaagggcgccctcttcatctgccagctctggcac
gtcggaagagtctccaacaacggtttccagcctgacggattggctcccatctcaagcacc
gacaaggcgatcacaccggacggctatgggatggtgtactccaagccgcgacggcttcgg
acagacgagatcccgcaaatcgtcgacgatttcaggctcgctgccaggaacgcagtcgag
gccgggttcgacggtgttgagatccacggcgcgaacggctacctcctcgagcaattcatg
aaggacagctccaacgaccgcaccgacgagtacggcggcagcctcgagaaccggtgccgc
ttcgccgtcgaggtgatcgacgccgtcgtcggcgagatcggcgcccacagcgtcggcatc
aggctgtcgccgttcctggactacatggactgcgtcgactccgacccggaggcactcggc
tcgtacatggtggagcagctgaacaagcacgaggatttcctctactgccacatggtggag
cctcgcatggccatcgtcgacggccgccggcaaattcagcacggcctcttgcccttcagg
aagcagttcaatggcacgttcatcgccgccggagggtacgaccgggaagaagggaacaag
gcggttgccgatggctatgccgacctcgtcgcctatgggaggctcttcttggcgaatcct
gatctgcccaagaggttcgagctcgatgcgcccatgaataactacgatcgcaacaccttc
tacacgcaggatcctgtggttgggtacaccgactatcctttccttgacgagcatcaccat
gacgacgacgatgactctaatgctccttctgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340485
Entry
4340485           CDS       T01015                                 
Name
(RefSeq) putative 12-oxophytodienoate reductase 5
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4340485
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     4340485
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 4340485
NCBI-ProteinID: XP_015644547
UniProt: Q69TI0
LinkDB
Position
6:complement(5884538..5886151)
AA seq 374 aa
MVNQAAMPLLTPYKQAGGKIDLSHRVLLSPMTRCRSYGNVPQPHAALYYTQRATSGGLLI
TEATGVSDTAQGYPETPGVWTREHVEAWKPIVDAVHRKGALFICQLWHVGRVSTNDYQPN
GQAPISSSDIQITPDGSGIVYSKPRRLRVDEIPQIVDDFRLAARNAIEAGFDGVEIHGAN
GYLLEQFMKDSSNDRTDEYGGSLENRCRFAVEVIDAVVGEIGAHRVGIRLSPFLDFMDCV
DSDPEALGSYMVEQLNKHEGFLYCHMVEPRMAIVDGRRQIQHGLLPFRKAFKGTFIAAGG
YDREEGNKVIENGYTDLVSFGRLFLANPDLPKRFELDAPLNKYDRNTFYTQDPIVGYTDY
PFLDEDQNNSVADA
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggtcaaccaagccgcgatgccgctgctgacaccgtacaagcaggctggcggcaagatc
gatctctcccaccgtgtgctgctctcgccgatgacgcggtgccgatcctacggcaacgtg
ccgcagccgcacgcggcgctgtactacacgcagcgcgccaccagcggcggcctcctcatc
acggaggccaccggcgtctccgacaccgcgcagggctacccggagacacccggcgtctgg
acgcgggagcacgtcgaggcgtggaagcccatcgtcgacgccgtccaccgcaagggcgcc
ctcttcatctgccagctctggcacgtcgggagagtctccaccaacgactaccagccaaat
gggcaggcaccgatctcaagctccgacatacagatcacaccggacggttcagggatcgtg
tactccaagcctcgccggctgcgggtcgacgagatccctcagatcgtcgacgacttcagg
ctcgccgcgcggaacgccatcgaggccgggttcgacggcgtggagatccacggcgccaac
ggctacctcctcgagcagttcatgaaggacagctccaacgaccgcaccgacgagtacggc
ggcagcctcgagaaccggtgccgcttcgccgtcgaggtgatcgacgccgtcgtcggcgag
atcggcgcccaccgcgtcggcatcaggctgtcgccgttcctggacttcatggactgcgtc
gactccgacccggaggctctcggctcgtacatggtggagcagctcaacaagcacgagggt
ttcctctactgccacatggtggagcctcgcatggccatcgtcgacggccgccggcagatt
cagcacggcctgctgccattcaggaaagctttcaagggcacgttcatcgccgccggtggg
tatgaccgggaggaaggcaacaaggtgatcgaaaatggctacactgatcttgtctccttt
ggaaggcttttcttggcgaaccctgacttgcctaagaggttcgagcttgatgcgccattg
aacaagtatgatcgcaacaccttctacactcaagacccaattgttggatacacggactac
cctttcctcgatgaggatcagaacaactcggttgctgatgcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340486
Entry
4340486           CDS       T01015                                 
Name
(RefSeq) putative 12-oxophytodienoate reductase 4
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4340486
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     4340486
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 4340486
NCBI-ProteinID: XP_015640930
UniProt: Q69TH8
LinkDB
Position
6:complement(5894796..5896505)
AA seq 380 aa
MAREAEKDAAAAAEIPLLTPYKMGRFELSHRVVLAPLTRNRSYGNVPRPHAVLYYTQRAT
SGGLLVTEATGVSDTAQGYPDTPGIWTQQQVEAWKPIVDAVHRKGALFICQLWHVGRVST
NEYQPDGQAPISSTDRQITPDDSGIVYSKPRRLRTEEIPQIIDDFRRAARNAIEAGFDGV
EIHGAHGYLLEQFMKDSANDRSDEYGGSLENRCRFVVEVIDAIVAEVGAHRVGIRLSPFI
DYMDCVDSDPVALGSYMVQQLNKHPGFLYCHMVEPRMAIVEGRRKITHGLLPFRKLFNGT
FIAAGGYDREEGNKVIADGYADLVAYGRHFLANPDLPKRFAINAPLNKYNRSTFYIQDPV
VGYTDYPFLDEKDEGAATYA
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcgcgcgaggcggagaaggacgcggcggcggcggcggagatcccgctgctgacgccg
tacaagatggggcggttcgagctctcccaccgtgtggtgctcgcgccgctcacgcggaac
cgctcctacggcaacgtgccgcggccgcacgcggtgctgtactacacgcagcgcgccacc
agcggcggcctcctcgtcacggaggccaccggcgtctccgacaccgcgcagggctacccg
gacacccccggcatctggacgcagcagcaggtcgaggcgtggaagcccatcgtcgacgcc
gtccaccgcaagggcgccctcttcatctgccagctctggcacgtcggcagggtctccacc
aacgaataccaacctgacgggcaggcgcccatctcaagcacagacaggcagatcacaccg
gacgattcaggcatcgtctactcgaaaccccgacggctgaggacggaggagatccctcag
atcatcgacgacttcaggcgagccgcgcggaacgccatcgaggccgggttcgacggcgtg
gagatccacggcgcgcacggctacctcctggagcagttcatgaaggacagcgccaacgac
cgcagcgacgagtacggtggcagcctcgagaaccggtgccgcttcgttgtcgaggtgatc
gacgccatcgtcgccgaggttggagcgcaccgtgtggggatcaggctgtcaccgttcatc
gactatatggactgcgtcgactccgacccggtggctctcggctcgtacatggtgcagcag
ctcaacaagcacccggggtttctctactgccacatggtggagccaagaatggccatcgtg
gaaggacgcaggaagatcacccatggcctcctgccattccggaagctgttcaatggcact
ttcatcgctgccggaggatacgatcgggaggaaggaaacaaggtgatagccgatggatat
gctgacctcgtcgcctacgggaggcacttcttggccaatccggacttgcccaagaggttc
gcgatcaacgcaccattgaacaagtataataggtccaccttttacatacaggatcctgtt
gttggctacacggactatcctttccttgatgagaaagacgagggcgctgctacttatgct
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340487
Entry
4340487           CDS       T01015                                 
Name
(RefSeq) putative 12-oxophytodienoate reductase 3
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4340487
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     4340487
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 4340487
NCBI-ProteinID: XP_015643918
UniProt: Q69TH6
LinkDB
Position
6:complement(5899395..5906237)
AA seq 382 aa
MVQAQAAAKEAAAAAIPLMAPYKMGRFELSHRVVLAPLTRCRSYDHVPQPHAALYYSQRA
TNGGLLISEATGVSATGEGYPEIPGVWTRQQVKAWKPIVDAVHRKGALFFCQLAHVGRAS
TNDQQPNGQAPISSTDKQITPDDSHTVYSKPRRLRTDEIPHVVDDFRVAARNAIEAGFDG
VEIHGAHGYLIDQFMKDSANGRTDQYGGSLENRCRFAVEVIDAVVAEVGADRVGIRLSPY
IDFMDCFDSNPEALGSYMVRQLNKHPELLYCHMVEPRMATVEGRRKINHGLLPFRKQFNG
TFIASGGYDREEGNKVVDDGYADLVAYGRLFLANPDLPRRFELNAPLNKYDGSTFYTHDP
VVGYTDYPFLEEKKEDSATVIV
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggtgcaagcgcaagcagcggcgaaagaggcggcggcggcagcgatcccgcttatggcg
ccgtacaagatggggcggttcgagctctcccaccgcgtggtgctcgcgccgctgactcgg
tgccgctcctacgaccacgtgccacagccgcacgcggcgctgtactactcgcagcgcgcc
accaatggcggcctcctcatctcggaggccaccggggtgtccgccaccggggagggctac
ccggagatccccggcgtctggacgcggcagcaggtcaaggcgtggaaacccatcgtcgac
gccgtccaccgcaagggcgcgctcttcttctgccagctagcgcacgtcggcagggcctcc
accaacgatcaacagccgaatgggcaggcgccgatctcaagcacagacaagcagatcaca
ccggacgattcacacacggtgtactccaagccccggcggctgcggacggatgagatccct
cacgtcgtcgacgatttcagggtggctgcgcggaacgccatcgaggcggggttcgacggc
gtggagatccacggcgcgcatggctacctcatcgatcagttcatgaaggacagcgccaac
ggccggaccgaccagtacggtggcagcctcgagaaccgttgccgcttcgccgtcgaggtg
atcgacgccgtcgtcgccgaggtgggagctgaccgtgttgggatcagattgtcgccatat
atagattttatggactgcttcgactcgaaccccgaagctctcggctcatacatggtgcgg
caactcaacaagcacccagagctcctctactgccacatggtggagccgaggatggccacc
gtcgaaggacggaggaagatcaaccatggcctcctgccatttcggaagcaattcaatggc
actttcattgcctccggagggtatgaccgggaggaagggaacaaggtggtggatgatggc
tatgccgacctcgtcgcctatgggaggctcttcttggccaaccccgacttgccaaggagg
ttcgagcttaatgcaccgttaaacaagtatgatggatctacattttacacacatgatccc
gtcgttggctacacggattaccctttccttgaggagaagaaagaggactcagctacagta
attgtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340490
Entry
4340490           CDS       T01015                                 
Name
(RefSeq) 12-oxophytodienoate reductase 1 isoform X2
  KO
K05894  12-oxophytodienoic acid reductase [EC:1.3.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4340490
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.42  12-oxophytodienoate reductase
     4340490
SSDB
Motif
Pfam: Oxidored_FMN
Other DBs
NCBI-GeneID: 4340490
NCBI-ProteinID: XP_015643915
UniProt: Q84QK0
LinkDB
Position
6:complement(5912641..5914603)
AA seq 380 aa
MVHAPAKVAAAAAIPLLTPYKMGQLELSHRVVLAPLTRCRSYGNVPQPHAAVYYSQRATR
GGLLIAEATDISPTAQGYPETPGIYTQQQIEAWKPIVDAVHRKGALFFLQIWHVGRVSTT
DFQPNGQAPISSTDKQITPDDSGMVYSKPRRLRTDEIPQIIDDFRRAARNAIEAGFDGVE
IHGAHGYLLEQFMKDSANDRTDEYGGSLENRCRFAVEVIDAVVAEVGAHRVGIRLSPFVD
FMDCFDSDPVALGSYMVQQLNKHPGFLYCHMVEPRMAIIEGRRKIAHGLLPFRKQFNGTF
IAAGGYDREEGNKVVADGYADLVAYGRLFLANPDLPRRFELDAPLNRYDRSTFYTQDPVV
GYTDYPFLEEIDEESRTTYA
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggtgcacgcaccggcgaaagtggcagctgcggcggcgatcccgctgctgacgccgtac
aagatggggcagctggagctctcccaccgtgtggtgctcgcgccgctcacgcggtgccgc
tcctacggcaacgtgccgcagccgcacgcggcggtgtactactcgcagcgggcgaccagg
ggcggcctcctcatcgcggaggccaccgacatctcccccaccgcgcagggctacccggag
acccccggcatctacacgcagcagcagatcgaggcgtggaagcccatcgtcgacgccgtc
caccgcaagggcgccctcttcttcctgcagatatggcacgtcggcagggtctccaccaca
gatttccagccgaatggacaggcgccgatctcaagcaccgacaagcagatcacaccggac
gattcaggcatggtgtactccaagccccggcggctccggacggatgagatccctcagatc
atcgacgacttcaggcgagccgcgcggaacgccatcgaggcggggttcgacggcgtggag
attcatggcgcgcacggctacctcctggagcagttcatgaaggacagcgccaacgaccgc
accgacgagtacggtggcagcctcgagaaccggtgccgcttcgccgtcgaggtgatcgac
gccgtcgtcgccgaggtgggagctcaccgtgtcggaatcagattatcgccgttcgtcgac
ttcatggactgcttcgactccgacccggtggctctcggctcatacatggtgcagcaactc
aacaagcacccagggtttctctactgccacatggtggagccaagaatggccataatcgaa
ggacgaaggaagatcgcccatggcctcctaccattcaggaagcagttcaatggcactttc
atcgctgctggcgggtatgaccgggaggaagggaacaaggtggtggctgatggctatgcc
gatctcgtcgcctatgggaggctcttcttggctaaccctgacttgccgaggaggtttgag
cttgacgcaccattgaacaggtatgacaggtctaccttttatacacaggatcccgttgtt
ggctatacagattacccttttcttgaggagattgatgaggagtcaagaactacttatgct
taa

DBGET integrated database retrieval system