KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277437
Entry
107277437         CDS       T01015                                 
Name
(RefSeq) arogenate dehydrogenase 2, chloroplastic-like
  KO
K15227  arogenate dehydrogenase (NADP+), plant [EC:1.3.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107277437
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.78  arogenate dehydrogenase (NADP+)
     107277437
SSDB
Motif
Pfam: F420_oxidored PDH_N NAD_binding_2 2-Hacid_dh_C NAD_Gly3P_dh_N Rossmann-like GFO_IDH_MocA DUF4906 ApbA
Other DBs
NCBI-GeneID: 107277437
NCBI-ProteinID: XP_015641140
UniProt: B9FQU4 Q5Z9H5
LinkDB
Position
6:complement(29987759..29989377)
AA seq 353 aa
MLSSSTSTHCLHQPPPPPASHQFRSAAAFRRPPSPAAAPLRARPQRGGGTTIRAIDAAQP
FDYESRAAGLLEERQRLKIAIVGFGNFGQFLARTFARQGHTLLAHSRSDYSSLAASVGAS
YFQDPHDLCECHPDVVLLATSILSAEAVLRSLPVHRLRRNTLFVDVLSVKEFPRNLLLGS
LPPDFDVICTHPMFGPESARDGWDGLPFVFDKVRVGDCPARRARAEAFLNIFEREGCRMV
EMTCAEHDAHAAETQFLTHTVGRMLAMLELRSTPINTKGYETLLRLVDNTCSDSFDLYNG
LFMYNKNSTELLNRLEWAMDSVKKKLFDGLHDVLRKQLFEGSPHAPNNTPVRK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctgtcgtcttccacctccacccactgcctccaccagccgccgccgccgccggcgagc
caccaattccggtcggccgccgcgttccgccgccctccgtctccggcggcggcgcccctc
cgcgcgcggccgcagcgcgggggcggcaccaccatccgcgccatcgacgcagcccagccg
ttcgactacgagtcccgcgcggcggggctcctggaggagcggcagcggctcaagatcgcc
atcgtcgggttcggcaacttcggccagttcctcgcccgcaccttcgcgcggcagggccac
acgctgctcgcccactcccgctccgactactcctccctcgccgcatccgtcggcgcgtcc
tacttccaggacccgcacgacctctgcgagtgccacccggatgtggtgctcctcgccacc
tccatcctctccgccgaggccgtcctccgctcgctccccgtccaccgcctccgccgcaac
accctcttcgtcgacgtgctctccgtcaaggagttccccaggaacctcctcctcggctcg
ctcccgccggacttcgacgtcatctgcacccaccccatgttcggcccggagtcggcgcgc
gacggctgggacggcctccccttcgtgttcgacaaggtccgcgtcggcgactgccccgcg
cgccgcgcccgcgccgaggccttcctcaacatcttcgagcgggaggggtgccgcatggtg
gagatgacctgcgccgagcacgacgcgcacgccgccgagacgcagttcctcacccacacc
gtcggccggatgctcgccatgctggagctccggtccacgccgatcaacaccaaggggtac
gagacgctgctccgcctcgtcgacaacacctgcagcgacagcttcgacctctacaatggc
ctcttcatgtacaacaagaactccaccgagctgctcaatcgcctcgaatgggccatggat
tccgtcaagaagaagctcttcgatggcctccacgacgtgctccggaagcagctcttcgag
ggctcgccgcacgctcccaacaacacccccgtcaggaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341232
Entry
4341232           CDS       T01015                                 
Name
(RefSeq) arogenate dehydrogenase 2, chloroplastic
  KO
K15227  arogenate dehydrogenase (NADP+), plant [EC:1.3.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4341232
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.78  arogenate dehydrogenase (NADP+)
     4341232
SSDB
Motif
Pfam: PDH_N F420_oxidored 2-Hacid_dh_C NAD_binding_2 Rossmann-like ApbA DUF1951
Other DBs
NCBI-GeneID: 4341232
NCBI-ProteinID: XP_015641943
UniProt: Q5Z6Y1 A0A0P0WXX8
LinkDB
Position
6:20400335..20403403
AA seq 342 aa
MASSPRHSTHHPTLLLRRHYPNFCALAPLRPTRQLPSLPQQQLQQKQHVGHDPSPSEPTT
AAASPATAAAAGALRVGIVGFGNFGQFIAGGIQRQGHAVLATSRSDYSGYCARHGIRFFA
TADELCEAGPDVLLVCSSILSTEAVVRAIPFRKLRPGTLVADVLSVKQFPRNLLLEILPP
GFGIVCTHPMFGPESGKHGWSGLPFVYDKVRVAKEGDQAAKCEQFLSIFEREGCRMVEML
CEEHDRYAAGSQFITHTIGRILSQLNLESTPINTKGYETLLQLTKNTISDSFDLYYGLFM
YNVNATEQIDNLDRAFEKVKQMLYGRLHNVLRKQIEERVPIP
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcgtcctccccgcgccattccacccaccaccccaccttgctcctccgccgccactac
cccaacttctgcgccctcgcccccctccgcccgaccaggcaactccccagccttccccag
cagcagctgcagcagaagcagcacgttggccatgatccgtcgccgtcggagcccaccacc
gcggccgcctcgccggcgacggcggcggcggcgggggcgctgcgtgtggggatcgtcggg
ttcggcaacttcgggcagttcatcgcgggggggatccagcggcaggggcacgcggtgctg
gccacctccagatccgactactcgggctactgcgcccgccacgggatccgcttcttcgcc
accgccgacgagctctgcgaggccgggcccgacgtcctgctcgtctgcagctccatcctc
tccaccgaggccgtcgtccgcgccatccccttccgcaagctccgccccggaaccctcgtc
gccgacgtgctctccgtcaagcagttcccccgcaacctcctcctcgagatcctccctccg
gggttcgggattgtatgtacgcaccccatgtttgggccggagagtggaaagcatggctgg
agtgggctaccttttgtctatgacaaggtccgtgttgccaaggaaggggatcaggcggcc
aagtgcgaacagttcttgagcatctttgagcgggagggatgtaggatggtggagatgttg
tgcgaagagcatgatcgctatgccgcgggaagtcagttcatcactcacactattgggagg
attttgtcacagctaaaccttgagtccacaccaatcaacaccaagggttatgagaccctt
ctgcaacttactaagaacacgataagtgatagtttcgatctgtactatgggcttttcatg
tacaatgtgaatgccacagaacagatagacaacctggacagggcatttgagaaggtgaag
cagatgctctatggtaggctgcataatgtactaagaaagcagatagaagagagggtccca
atcccgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342026
Entry
4342026           CDS       T01015                                 
Name
(RefSeq) arogenate dehydrogenase 2, chloroplastic
  KO
K15227  arogenate dehydrogenase (NADP+), plant [EC:1.3.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4342026
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.78  arogenate dehydrogenase (NADP+)
     4342026
SSDB
Motif
Pfam: PDH_N F420_oxidored NAD_binding_2 2-Hacid_dh_C Shikimate_DH NAD_Gly3P_dh_N Rossmann-like TrkA_N ApbA ELFV_dehydrog
Other DBs
NCBI-GeneID: 4342026
NCBI-ProteinID: XP_015643511
UniProt: A3BFA4 Q5Z9H3
LinkDB
Position
6:29994598..29996085
AA seq 384 aa
MAMSCSSSSSSVRLRLNLAPSRRRIAAPANLQVLRRVGVAAASIRLRAARATGGDARQPF
DHVPRGVEEVGEMEEDEERRRRRGLKIAVVGFGNYGQFLTRTLVRQGHTVLAHSRSDYSA
VAAELGATYFTDAHDLVECHPDVVLLVTSILSAEAVLRSLPVHRLRRDTLFADVLSVKEF
PRNLLLGTLPEEFDIICTHPMFGPESAGDGWGGLPFVFDKVRVGDCPARRARAEAFLDIF
AREGCRMVEMSCAEHDAHAAETQFLTHTVGRTLAMLELQTTPINTKGYETLLRLVDNTCS
DSFDLYNGLFMYNNNSTELLNRLEWAMDSVKKRLFDGLHDVLRRQLFEGSPPLDSVSAAA
AGSPPDDAPIDGDLDSDNEEEQSE
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggcgatgtcgtgctcttcctcctcctcctccgtgcgcctccgattgaatctagcgccc
tcccgccgccgaatcgccgctcccgccaacctccaggtgctccggcgcgtgggagtggcg
gcggcttcaatccggcttcgtgccgcccgcgccacgggaggtgatgcacggcaaccgttc
gaccatgtgcctcgcggcgttgaggaggttggtgagatggaggaggacgaggagcggcgg
aggcggaggggtctcaagatcgccgtcgtggggtttgggaactatgggcagttcctgacc
aggacgctggtgcggcaggggcacaccgtcctggcgcactcgcgctcagactactccgcc
gtggcggccgagctcggcgcgacgtacttcaccgacgcgcacgatctcgtcgagtgccac
ccggatgtggtgctcctcgtcacctccatcctctccgccgaggccgtcctccgctcgctc
cccgtccaccgcctccgccgcgacaccctcttcgccgacgtgctctccgtcaaggagttc
cccaggaacctcctcctcggcacgctcccggaggagttcgacatcatctgcacccaccct
atgttcggcccggagtccgcgggcgacgggtggggcggcctccccttcgtgttcgacaag
gtccgcgtcggcgactgcccggcgcgccgcgcccgcgccgaggccttcctcgacatcttc
gcgcgcgagggctgccgcatggtggagatgagctgcgccgagcacgacgcgcacgccgcc
gagacgcagttcctcacccacaccgtcggacgaacactcgccatgctggagctccaaaca
actccgatcaacaccaaggggtacgagacgctgctccgcctcgtcgacaacacctgcagc
gacagcttcgacctctacaatggcctcttcatgtacaacaacaactccaccgagctcctc
aaccgcctcgaatgggccatggattccgtcaagaagaggctcttcgacggcctccacgac
gtgctccggcggcagctcttcgagggctcgccgccgttggactccgtctccgccgccgca
gccgggtcgccgccggatgacgcaccaatcgatggcgatcttgacagcgacaacgaggag
gagcaatcggagtaa

DBGET integrated database retrieval system