KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277478
Entry
107277478         CDS       T01015                                 
Name
(RefSeq) probable high-affinity nitrate transporter 2.4
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
Module
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    107277478
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    107277478
Transporters [BR:osa02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    107277478
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 107277478
NCBI-ProteinID: XP_015636108
UniProt: A2ZU80
LinkDB
Position
1:complement(20385987..20388532)
AA seq 485 aa
MVAMEKKTKLVEEEDGCYYYDYGGYGDGVVDDEGRATELRPMALSRPHTQAFHLAWMSLF
ACFFAAFAAPPILPAMRPALVLAPSDASAAAVASLSATLVGRLAMGPACDLLGPRRASGV
ASLVCALALALAAVFASSPAGFVALRFVAGLSLANFVANQHWMSRIFAPSAVGLANAVAA
GWANVGSAAAQVVMPVAYDAVVLRLGVPVTVAWRVTYLLPCAMLVTTGLAVLAFPYDLPG
GGGGRCPGGGGGRRRSFWAVVRGGVGDYRAWLLGLTYGHCYGVELIMENVAADFFRRRFR
LPMEAAGAAAACFGAMNAVARPAGGVASDEVARRFGMRGRLWALWAVQSAGAALCVLVGR
MGAAEAPSLAATVAVMVACAAFVQAASGLTFGIVPFVCKRSLGVVSGMTASGGAVGAIVT
NRLFFSGSRYTVEEAISCTGITSLLCTLPVALIHFRRQGGMFCGPSATIDGDGDVDDDDD
YMLLK
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggtcgccatggagaagaagacgaagctggtggaagaagaagatggctgctactactac
gactacggcggctatggcgatggcgtcgtcgacgacgaggggagggcgacggagctgcgg
ccgatggcgctgtcgcggccgcacacgcaggcgttccacctggcgtggatgtccctcttc
gcgtgcttcttcgccgccttcgccgcgccgcccatcctcccggcgatgcgcccggcgctc
gtgctcgcgccctccgacgcctcggcggccgccgtggcctcgctctcggcgacgctggtg
gggaggctcgccatgggccccgcctgcgacctcctcggcccgcgccgcgcgtccggggtc
gccagcctcgtgtgcgcgctggcgctcgcgctcgccgccgtgttcgcgtcctcccccgcg
gggttcgtcgcgctccggttcgtggctggcctctcgctcgccaacttcgtcgccaaccag
cactggatgtcgcggatcttcgcgccctccgccgtggggctcgccaacgccgtcgccgcc
gggtgggcgaacgtcggcagcgccgccgcgcaggtggtcatgccggtcgcctacgacgcc
gtcgtgctccgcctcggcgtccccgtcaccgtcgcgtggcgcgtcacctacctactcccg
tgcgccatgctcgtcaccacgggcctcgccgtgctcgccttcccctacgacctcccgggc
ggcggcggtggtcgctgccccggcggcggcggcgggcggaggaggagcttctgggcggtg
gtgcggggcggcgtcggcgactaccgagcgtggttgctgggcctcacctacggccactgc
tacggcgtggagctgatcatggagaacgtggcggcggacttcttccgcaggcggttccgg
ctgcccatggaggccgcgggcgccgccgcggcgtgcttcggcgcgatgaacgcggtggcg
cggccggccggaggggtggcctccgacgaggtggcgaggcggttcgggatgcgcgggcgg
ctgtgggcgctgtgggccgtgcagagcgccggcgccgcgctctgtgtgctcgtcggcagg
atgggcgccgcggaggcgccgtcgctggcggcgaccgtggccgtcatggtggcgtgcgcg
gcgttcgtgcaggccgcctccggcctcaccttcggcatcgttcccttcgtctgcaaaagg
tcgctgggcgtggtgtcgggcatgacggcgagcggcggcgcggtgggggcgatcgtgacg
aaccggctcttcttcagcgggtccaggtacacggtggaggaggccatctcctgcaccggc
atcaccagcctcctctgcacgctccccgtcgccctcatccatttccggcgacagggcggc
atgttctgtggcccatcggccacgatcgacggcgacggcgatgttgatgacgatgatgat
tacatgcttctgaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324249
Entry
4324249           CDS       T01015                                 
Name
(RefSeq) high-affinity nitrate transporter 2.3
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
Module
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4324249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4324249
Transporters [BR:osa02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    4324249
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 4324249
NCBI-ProteinID: XP_015628524
UniProt: Q94JG1
LinkDB
Position
1:29188837..29191001
AA seq 516 aa
MEAKPVAMEVEGVEAAGGKPRFRMPVDSDLKATEFWLFSFARPHMASFHMAWFSFFCCFV
STFAAPPLLPLIRDTLGLTATDIGNAGIASVSGAVFARLAMGTACDLVGPRLASASLILL
TTPAVYCSSIIQSPSGYLLVRFFTGISLASFVSAQFWMSSMFSAPKVGLANGVAGGWGNL
GGGAVQLLMPLVYEAIHKIGSTPFTAWRIAFFIPGLMQTFSAIAVLAFGQDMPGGNYGKL
HKTGDMHKDSFGNVLRHALTNYRGWILALTYGYSFGVELTIDNVVHQYFYDRFDVNLQTA
GLIAASFGMANIISRPGGGLLSDWLSSRYGMRGRLWGLWTVQTIGGVLCVVLGIVDFSFA
ASVAVMVLFSFFVQAACGLTFGIVPFVSRRSLGLISGMTGGGGNVGAVLTQYIFFHGTKY
KTETGIKYMGLMIIACTLPVMLIYFPQWGGMLVGPRKGATAEEYYSREWSDHEREKGFNA
ASVRFAENSVREGGRSSANGGQPRHTVPVDASPAGV
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggaggctaagccggtggcgatggaggtggagggggtcgaggcggcggggggcaagccg
cggttcaggatgccggtggactccgacctcaaggcgacggagttctggctcttctccttc
gcgaggccacacatggcctccttccacatggcgtggttctccttcttctgctgcttcgtg
tccacgttcgccgcgccgccgctgctgccgctcatccgcgacaccctcgggctcacggcc
acggacatcggcaacgccgggatcgcgtccgtgtcgggcgccgtgttcgcgcgtctggcc
atgggcacggcgtgcgacctggtcgggcccaggctggcctccgcgtctctgatcctcctc
accacaccggcggtgtactgctcctccatcatccagtccccgtcggggtacctcctcgtg
cgcttcttcacgggcatctcgctggcgtcgttcgtgtcggcgcagttctggatgagctcc
atgttctcggcccccaaagtggggctggccaacggcgtggccggcggctggggcaacctc
ggcggcggcgccgtccagctgctcatgccgctcgtgtacgaggccatccacaagatcggt
agcacgccgttcacggcgtggcgcatcgccttcttcatcccgggcctgatgcagacgttc
tcggccatcgccgtgctggcgttcgggcaggacatgcccggcggcaactacgggaagctc
cacaagactggcgacatgcacaaggacagcttcggcaacgtgctgcgccacgccctcacc
aactaccgcggctggatcctggcgctcacctacggctacagcttcggcgtcgagctcacc
atcgacaacgtcgtgcaccagtacttctacgaccgcttcgacgtcaacctccagaccgcc
gggctcatcgccgccagcttcgggatggccaacatcatctcccgccccggcggcgggcta
ctctccgactggctctccagccggtacggcatgcgcggcaggctgtgggggctgtggact
gtgcagaccatcggcggcgtcctctgcgtggtgctcggaatcgtcgacttctccttcgcc
gcgtccgtcgccgtgatggtgctcttctccttcttcgtccaggccgcgtgcgggctcacc
ttcggcatcgtgccgttcgtgtcgcggaggtcgctggggctcatctccgggatgaccggc
ggcgggggcaacgtgggcgccgtgctgacgcagtacatcttcttccacggcacaaagtac
aagacggagaccgggatcaagtacatggggctcatgatcatcgcgtgcacgctgcccgtc
atgctcatctacttcccgcagtggggcggcatgctcgtaggcccgaggaagggggccacg
gcggaggagtactacagccgggagtggtcggatcacgagcgcgagaagggtttcaacgcg
gccagcgtgcggttcgcggagaacagcgtgcgcgagggcgggaggtcgtcggcgaatggc
ggacagcccaggcacaccgtccccgtcgacgcgtcgccggccggggtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328051
Entry
4328051           CDS       T01015                                 
Name
(RefSeq) high-affinity nitrate transporter 2.1
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
Module
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4328051
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4328051
Transporters [BR:osa02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    4328051
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 4328051
NCBI-ProteinID: XP_015623638
UniProt: P0DKG9 P0DKH0
LinkDB
Position
2:655310..657326
AA seq 533 aa
MDSSTVGAPGSSLHGVTGREPAFAFSTEVGGEDAAAASKFDLPVDSEHKAKTIRLLSFAN
PHMRTFHLSWISFFSCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLAMG
AICDMLGPRYGCAFLIMLAAPTVFCMSLIDSAAGYIAVRFLIGFSLATFVSCQYWMSTMF
NSKIIGLVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGTLHVVMG
VLVLTLGQDLPDGNLRSLQKKGDVNRDSFSRVLWYAVTNYRTWIFVLLYGYSMGVELTTD
NVIAEYFYDRFDLDLRVAGIIAASFGMANIVARPTGGLLSDLGARYFGMRARLWNIWILQ
TAGGAFCLLLGRASTLPTSVVCMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGG
NFGAGLTQLLFFTSSRYSTGTGLEYMGIMIMACTLPVVLVHFPQWGSMFLPPNAGAEEEH
YYGSEWSEQEKSKGLHGASLKFAENSRSERGRRNVINAAAAAATPPNNSPEHA
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggactcgtcgacggtgggcgctccggggagctcgctgcacggcgtgacggggcgcgag
ccggcgttcgcgttctcgacggaggtgggcggcgaggacgcggcggcggcgagcaagttc
gacttgccggtggactcggagcacaaggcgaagacgatcaggttgctgtcgttcgcgaac
ccgcatatgaggacgttccacctatcatggatctccttcttctcctgcttcgtctccacc
ttcgccgccgcccctctcgtccccatcatccgcgacaacctcaacctcaccaaggccgac
atcggcaacgccggcgtcgcctccgtctccggctccatcttctccaggctcgccatgggc
gccatctgcgacatgctcggcccgcgctacggctgcgccttcctcatcatgctcgccgcg
cccaccgtcttctgcatgtcgctcatcgactccgccgcggggtacatcgccgtgcgcttc
ctcatcggcttctccctcgccaccttcgtgtcatgccagtactggatgagcaccatgttc
aacagcaagatcatcggcctcgtcaacggcctcgccgccgggtggggaaacatgggcggc
ggcgcgacgcagctcatcatgccgctcgtctacgacgtgatccgcaagtgcggcgcgacg
ccgttcacggcgtggaggctggcctacttcgtgccggggacgctgcacgtggtgatgggc
gtgctggtgctgacgctggggcaggacctccccgacggcaacctgcgcagcctgcagaag
aagggtgacgtcaacagggacagcttctccagggtgctctggtacgccgtcaccaactac
cgcacctggatcttcgtcctcctctacggctactccatgggcgtcgagctcaccaccgac
aacgtcatcgccgagtacttctacgatcgcttcgacctcgacctccgcgtcgccggcatc
atcgccgcatccttcggcatggccaacatcgtcgcgcgccccaccggcggcctcctctcg
gacctcggcgcgcgctacttcggcatgcgcgcccgcctctggaacatttggatcctccag
accgccggcggcgcgttctgcctcctgctcggccgcgcatccaccctccccacctccgtc
gtctgcatggtcctcttctccttctgcgcgcaggccgcctgcggcgccatcttcggcgtc
atccccttcgtctcccgccgctcgctcggcatcatctccggcatgaccggcgccggcggc
aacttcggcgccgggctcacgcagctgctcttcttcacgtcgtcgaggtactccacgggc
acggggctggagtacatgggcatcatgatcatggcgtgcacgctgccggtggtgctcgtc
catttcccgcagtggggctccatgttcctcccgcccaacgccggcgccgaggaggagcac
tactacggctccgagtggagcgaacaggagaagagcaagggcctccacggtgcaagtctc
aagttcgccgagaactcccgctccgagcgtggccgccgcaacgtcatcaacgccgccgcc
gccgccgccacgccgcccaacaactcgccggagcacgcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328052
Entry
4328052           CDS       T01015                                 
Name
(RefSeq) high-affinity nitrate transporter 2.1
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
Module
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4328052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4328052
Transporters [BR:osa02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    4328052
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 4328052
NCBI-ProteinID: XP_015623596
UniProt: P0DKG9 P0DKH0
LinkDB
Position
2:complement(667179..669065)
AA seq 533 aa
MDSSTVGAPGSSLHGVTGREPAFAFSTEVGGEDAAAASKFDLPVDSEHKAKTIRLLSFAN
PHMRTFHLSWISFFSCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLAMG
AICDMLGPRYGCAFLIMLAAPTVFCMSLIDSAAGYIAVRFLIGFSLATFVSCQYWMSTMF
NSKIIGLVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGTLHVVMG
VLVLTLGQDLPDGNLRSLQKKGDVNRDSFSRVLWYAVTNYRTWIFVLLYGYSMGVELTTD
NVIAEYFYDRFDLDLRVAGIIAASFGMANIVARPTGGLLSDLGARYFGMRARLWNIWILQ
TAGGAFCLLLGRASTLPTSVVCMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGG
NFGAGLTQLLFFTSSRYSTGTGLEYMGIMIMACTLPVVLVHFPQWGSMFLPPNAGAEEEH
YYGSEWSEQEKSKGLHGASLKFAENSRSERGRRNVINAAAAAATPPNNSPEHA
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggactcgtcgacggtgggcgctccggggagctcgctgcacggcgtgacggggcgcgag
ccggcgttcgcgttctcgacggaggtgggcggcgaggacgcggcggcggcgagcaagttc
gacttgccggtggactcggagcacaaggcgaagacgatcaggttgctgtcgttcgcgaac
ccgcatatgaggacgttccacctatcatggatctccttcttctcctgcttcgtctccacc
ttcgccgccgcccctctcgtccccatcatccgcgacaacctcaacctcaccaaggccgac
atcggcaacgccggcgtcgcctccgtctccggctccatcttctccaggctcgccatgggc
gccatctgcgacatgctcggcccgcgctacggctgcgccttcctcatcatgctcgccgcg
cccaccgtcttctgcatgtcgctcatcgactccgccgcggggtacatcgccgtgcgcttc
ctcatcggcttctccctcgccaccttcgtgtcatgccagtactggatgagcaccatgttc
aacagcaagatcatcggcctcgtcaacggcctcgccgccgggtggggaaacatgggcggc
ggcgcgacgcagctcatcatgccgctcgtctacgacgtgatccgcaagtgcggcgcgacg
ccgttcacggcgtggaggctggcctacttcgtgccggggacgctgcacgtggtgatgggc
gtgctggtgctgacgctggggcaggacctccccgacggcaacctgcgcagcctgcagaag
aagggtgacgtcaacagggacagcttctccagggtgctctggtacgccgtcaccaactac
cgcacctggatcttcgtcctcctctacggctactccatgggcgtcgagctcaccaccgac
aacgtcatcgccgagtacttctacgatcgcttcgacctcgacctccgcgtcgccggcatc
atcgccgcatccttcggcatggccaacatcgtcgcgcgccccaccggcggcctcctctcg
gacctcggcgcgcgctacttcggcatgcgcgcccgcctctggaacatttggatcctccag
accgccggcggcgcgttctgcctcctgctcggccgcgcatccaccctccccacctccgtc
gtctgcatggtcctcttctccttctgcgcgcaggccgcctgcggcgccatcttcggcgtc
atccccttcgtctcccgccgctcgctcggcatcatctccggcatgaccggcgccggcggc
aacttcggcgccgggctcacgcagctgctcttcttcacgtcgtcgaggtactccacgggc
acggggctggagtacatgggcatcatgatcatggcgtgcacgctgccggtggtgctcgtc
catttcccgcagtggggctccatgttcctcccgcccaacgccggcgccgaggaggagcac
tactacggctccgagtggagcgaacaggagaagagcaagggcctccacggtgcaagtctc
aagttcgccgagaactcccgctccgagcgtggccgccgcaacgtcatcaacgccgccgcc
gccgccgccacgccgcccaacaactcgccggagcacgcctaa

DBGET integrated database retrieval system