KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277483
Entry
107277483         CDS       T01015                                 
Name
(RefSeq) transcription factor TCP21-like
  KO
K16221  transcription factor TCP21 (protein CCA1 HIKING EXPEDITION)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    107277483
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    107277483
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   TCP
    107277483
SSDB
Motif
Pfam: TCP
Other DBs
NCBI-GeneID: 107277483
NCBI-ProteinID: XP_015629543
LinkDB
Position
3:17598115..17600423
AA seq 167 aa
MPCHIHGGAALDKQLVPTASKANGTTLAVRKPPSKDRHSKVDGRGRRVRMPIICAARVFQ
LTRKLGLKSDGQTIEWLLREAEPSIIGATGTGTTLASYHTTSPSPTLASDAPVEGFWVLS
AGADFGQFWSFAAVREMMAATAAPAMLGEAFAASVGNYLYLTVSSNK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgccttgtcatatccatggcggcgccgctctggacaagcaactcgtccccaccgcctcc
aaagccaatggcaccaccctcgctgtccgcaagcctccctccaaggaccgccatagcaag
gtcgacggccgcggccgccgcgtccgcatgcccatcatctgcgctgcccgtgttttccag
ctcacccgcaagcttggcctaaagtccgacggccagactatcgagtggctcctccgcgag
gctgagccatccatcattggcgccactggcaccggcaccaccctagcctcctaccacacc
acctccccctcgcccactcttgcttctgacgcccccgtcgagggcttctgggtgctctcc
gcaggggctgacttcggccaattctggagctttgcggccgtgcgggagatgatggccgcc
accgcggcgcccgccatgcttggggaggccttcgccgccagtgttggcaactacctctat
ttgactgtttcttccaataagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330080
Entry
4330080           CDS       T01015                                 
Name
(RefSeq) transcription factor TCP7
  KO
K16221  transcription factor TCP21 (protein CCA1 HIKING EXPEDITION)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4330080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4330080
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   TCP
    4330080
SSDB
Motif
Pfam: TCP
Other DBs
NCBI-GeneID: 4330080
NCBI-ProteinID: XP_015624938
UniProt: A0A0P0VM35 Q6H878
LinkDB
Position
2:25497323..25498456
AA seq 211 aa
MSSRDAAATFHVYQPVQIPTATVAPAAAVSAAPAEAVAQLVPAPSKKAAGAAGGKDRHSK
VNGRGRRVRMPIVCAARVFQLTRELGLKSDGQTIEWLLRQAEPSILAATGTGTTPAAFVS
SSAPSTSSSHQHTLLGKRQRQESAAADAVSVAGAASAFWAALPAPGRPDAWGFSPLDAQP
TYVPMAQAHHHHLNLLAALSGAARRAEEESR
NT seq 636 nt   +upstreamnt  +downstreamnt
atgagctcccgcgacgccgccgccacgttccatgtctaccagcccgtgcagatcccgacg
gccacggtggcgcccgctgcggcagtgtcggcggcgccggcagaggccgtcgcccagctg
gtcccggcgccgagcaagaaggcggccggcgcggcgggtgggaaggaccggcacagcaag
gtgaacgggcgcgggcggcgcgtgcggatgccgatcgtgtgcgcggcgcgggtgttccag
ctcacgcgggagctggggctcaagtccgacggccagaccatcgagtggctgctccgccag
gccgagccgtccatcctcgccgccacggggaccggcaccaccccggccgccttcgtctcc
tcctccgcgccgtccacctcctcctcgcaccagcacaccctcctcggcaagcgccagcgc
caggagtccgccgccgccgacgccgtctccgtcgccggcgccgcgtccgcgttctgggcg
gcgctgcccgcaccaggccggcccgacgcctggggcttctccccgctggacgcgcagccg
acgtacgtgccgatggcgcaggcgcaccaccaccacctcaacctcctcgccgcgctctcc
ggcgccgccaggcgcgccgaggaggagtcccggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272106
Entry
9272106           CDS       T01015                                 
Name
(RefSeq) transcription factor TCP7
  KO
K16221  transcription factor TCP21 (protein CCA1 HIKING EXPEDITION)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    9272106
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    9272106
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   TCP
    9272106
SSDB
Motif
Pfam: TCP
Other DBs
NCBI-GeneID: 9272106
NCBI-ProteinID: XP_015627477
UniProt: A0A0P0VRQ5 Q6K7P2
LinkDB
Position
2:complement(35608851..35610806)
AA seq 236 aa
MTTRPDGGGGGGGAPDKQLVPASNANGTALAVRKPPSKDRHSKVDGRGRRIRMPIICAAR
VFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTSSPSSLRSNSTSNSNDL
LLPRAAPFILGKRLRAADDHTTSPAPAPDATAPTQAFWALPARADFGQLWSFAAAPEMMV
AAAAAPAMPGEASAARVGNYLPMAQGNLNLLASFSGGPGGAGATAATGRPEEESAR
NT seq 711 nt   +upstreamnt  +downstreamnt
atgacgaccaggccagacggcggcggtggcggtggcggcgctccggacaagcagctcgtc
ccggcctccaacgccaatggcaccgccctcgccgttcgcaagcctccctccaaggaccgc
cacagcaaggtcgacggccgcggccgccgcatccgcatgcccatcatctgcgccgcccgc
gtcttccagctcacccgcgagctcggccacaagtccgacggccagaccatcgagtggctc
ctccgccaggccgagccctccatcatcgccgccaccggcaccggcaccaccccggcctcc
ttctccacctcctccccttcctccctccgctccaactccacctccaactccaacgacctc
ctcctcccccgcgccgcccccttcatcctcggcaagcgcctccgtgccgccgacgaccac
accacttcgcccgcgcccgctcccgacgccaccgcccccacccaggccttctgggcgctc
ccggccagggctgacttcggccagctctggagcttcgccgccgcgccggagatgatggtc
gccgccgccgccgcacccgccatgcctggggaggcgtccgccgccagggtcggcaactac
ctccccatggcgcagggcaacctcaaccttctcgcctccttctccggcggcccaggaggc
gccggggccacggcggcgaccggccgacccgaggaggagagcgcccgctga

DBGET integrated database retrieval system