KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277487
Entry
107277487         CDS       T01015                                 
Name
(RefSeq) PHD finger-like domain-containing protein 5B
  KO
K12834  PHD finger-like domain-containing protein 5A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107277487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    107277487
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    107277487
 Complex B
    107277487
 Complex C
   U2 SnRNP specific factors
    107277487
SSDB
Motif
Pfam: PHF5
Other DBs
NCBI-GeneID: 107277487
NCBI-ProteinID: XP_015616550
UniProt: Q2R3Z0 A0A0P0Y2V6
LinkDB
Position
11:complement(17596201..17596908)
AA seq 129 aa
MAKHQADLVRCSRQPGAAVGRVCAAHDGRCVACDSMVRPAAPARVCDGCSGGGGGHGSRS
ERCLVCGAGAGEGGAAAVADAYYCRSCVQMEKDRDGCPAVVNAGTARRDAAAFFFSARSK
RGGFRSTMA
NT seq 390 nt   +upstreamnt  +downstreamnt
atggcgaagcaccaggccgacctcgtgaggtgctcgcggcagccgggcgccgccgtcggc
cgcgtctgcgcggcgcacgacggccgctgcgtcgcctgcgactccatggtgcggcccgcc
gcgccggcccgcgtctgcgacggctgcagcggcggcggcggcgggcacggctcccgcagc
gagaggtgcctggtgtgcggcgccggcgccggagaaggaggtgcggcggcggtggcggat
gcgtactactgcaggtcgtgcgtgcagatggagaaggatcgcgacggctgccccgccgtc
gtcaacgccggcacggccaggagggacgccgccgccttcttcttctccgcgaggagcaag
cgtggtggcttcagatcaacaatggcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325082
Entry
4325082           CDS       T01015                                 
Name
(RefSeq) splicing factor 3B subunit 4 isoform X1
  KO
K12831  splicing factor 3B subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4325082
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4325082
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4325082
 Complex B
    4325082
 Complex C
   U2 SnRNP specific factors
    4325082
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 4325082
NCBI-ProteinID: XP_015621556
UniProt: Q5N8W6
LinkDB
Position
1
AA seq 204 aa
MARNPTRTVYIGNLDEKVTERILYEILIQPGRVVDLCIPRDKETSCPKGYAFAEYETEEI
AQYAVQLFSGLVRLYGKTLKFAISGQDKPSSNGNNPVMPKLNPVPLPKQPQFVHHSDMHV
LHTPADPMVNGGTRDYGFSNYYPYSANPQALPVGPVHSYRGFSNGTYDCSTCIFGSIVNG
RYGDYVLNAAGHGAPRQPMLYPSY
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcgaggaaccctacccgcaccgtctacataggtaacttggatgaaaaggtaactgaa
agaatattgtatgagattcttattcagccaggtcgtgtagtagacctatgcatacctcgt
gacaaggaaactagttgtcccaaaggttacgcttttgctgagtatgaaacagaggaaatc
gcacagtatgctgttcaacttttttcaggacttgttcggctttatggtaaaacactcaaa
tttgcgatctctggacaagacaaaccctcatcaaatggcaataatccagtaatgcctaaa
ctcaatcctgtaccattaccaaagcagcctcagtttgtgcatcatagtgatatgcatgta
ttgcataccccagcggatccaatggtaaatggtgggacaagagattatggcttttcaaac
tattatccttatagtgctaatccccaagcattaccagttggacccgtgcatagctacaga
gggttcagcaatggtacgtatgattgcagtacatgcatatttggttctattgttaatggt
aggtatggagattatgttttgaatgctgctggccatggagctccgaggcaaccaatgttg
tatccgtcctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328237
Entry
4328237           CDS       T01015                                 
Name
(RefSeq) splicing factor 3B subunit 3
  KO
K12830  splicing factor 3B subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4328237
   03041 Spliceosome [BR:osa03041]
    4328237
   03036 Chromosome and associated proteins [BR:osa03036]
    4328237
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     4328237
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4328237
 Complex B
    4328237
 Complex C
   U2 SnRNP specific factors
    4328237
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    STAGA complex
     4328237
    TFTC complex
     4328237
SSDB
Motif
Pfam: MMS1_N CPSF_A
Other DBs
NCBI-GeneID: 4328237
NCBI-ProteinID: XP_015625882
UniProt: Q6YXY3
LinkDB
Position
2:1978406..1983630
AA seq 1234 aa
MYLYSLTLQRATGAVCAVIGSFSGRDSKKSAASGSSSSSSSTQEIAVARGTTLELLRPDP
ETGRLRTLLSVDVFGAIRSLAQFRLTGATKDYLVVGSDSGRLVILEYSPDRNRLDKVHQE
TFGKSGCRRIVPGQLLAVDPKGRALCIAALEKQKLVYVLNRDAAARLTISSPLEAHKSNT
LTFSLTALDCGFDNPVFAAIELEYAESDRDPTGQAAEQAQKHLTFYELDLGLNHVSRKAS
EPIDNGANLLVTVPGGGDGPSGLLVCCDNFVLYRNQGHPEVRAVIPRRADLPAERGVLIV
AAATHRQKSLFFFLLQTEYGDIFKVDLEHSNDTVTELRIKYFDTIPVTSAICVLRSGFLF
AASEFGNHALYQFRDIGRDVDVESSSATLMETDEGFQPVFFQPRALKNLYRIDEIESLMP
IMDMRVANLFDEETPQVFTACGRGPRSTLRILRPGLAISEMARSMLPAEPIAVWTVKKNI
NDMFDAYIVVSFANVTLVLSIGETIEEVSDSQFLDTTHSLAVSLLGEDSLMQVHPNGIRH
IREDGRVNEWRTPGKKTITKVGSNRLQVVIALSGGELIYFEMDMTGQLMEVEKQDMSGDV
ACLAIAPVPEGRQRSRFLAVGSFDNTIRILSVDPDDCLQPLSVQSVSSAPESLMFLEVQA
SVGGEDGADHPANLFLNAGLQNGVLFRTNVDMVTGQLSDTRSRFLGLRPPKLFPCIVSHR
QAMLCLSSRPWLGYIHQGHFLLTPLSCDTLESAASFSSDQCSEGVVAVAGDALRIFTIEH
LGETFNETAIPLRYTPRKFVILPKKKYLAVIESDKGALSAEEREAAKKECLEAAGVTENG
NANNGDQMENGDGQEDGAEDRNTLPDEQYGYPKAESERWVSCIRILDPKSRDTTCLLELQ
DNEAAVSICTVNFHDKEHGTLLAVGTAKGLQFWPKRNLSAGFIHIYKFVDEGRSLELLHK
TQVEEVPLALCQFQGRLLAGVGSVLRLYDLGKRKLLRKCENKLFPRTIVSIHTYRDRIYV
GDMQESFHYCKYRRDENQLYIFADDSVPRWLTAANHIDFDTMAGADKFGNIYFARLPQDL
SDEIEEDPTGGKIKWEQGKLNGAPNKVEEIVQFHVGDVVTCLQKASLIPGGGECLIYGTV
MGSVGALLAFTSREDVDFFSHLEMHLRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQF
PSLPADMQRKIADELDRTPGEILKKLEDIRNKII
NT seq 3705 nt   +upstreamnt  +downstreamnt
atgtacctctacagcctgacgctgcagcgggcgacgggcgcggtgtgcgccgtcatcggc
agcttcagcgggcgcgactcgaagaagtcggcggcgtccgggtcgtcgtcgtcgtcgtcg
tccacgcaggagatcgccgtggcccgtggcaccactctcgagctcctccgccccgacccg
gagaccggccgcctccgcacgctcctctccgtcgacgtcttcggcgccatccgctcgctc
gcccagttccgcctcaccggcgccaccaaggactacctcgtcgtcggctccgactccggc
cgcctcgtcatcctcgagtactcccccgaccgcaaccgcctcgacaaggtccaccaggag
accttcggcaagtccggctgccgccgcatcgtccccggccagctcctcgccgtcgacccc
aagggccgcgccctctgcatcgccgccctcgagaagcagaagctcgtctacgtcctcaac
cgtgacgccgccgcgcgcctcaccatctcgtctcctctcgaggcgcacaagtccaacacg
ctcaccttctccctcactgccctcgactgcgggttcgacaaccctgtcttcgccgccatt
gagcttgagtacgccgagtccgaccgcgaccccaccgggcaggctgccgagcaggcgcag
aagcacctcacattctatgagctagacctggggctcaatcatgtctcgcgcaaggcctcc
gagccgatagataacggtgctaatctactggtgactgtgcctggtggtggtgatgggcca
agcgggctcctcgtgtgctgcgacaactttgtgctttaccggaaccaggggcacccggaa
gtgcgggctgtcattccacgccgcgctgatctcccggctgagcggggtgtcctcatagtc
gcagccgccacgcacaggcagaagagcttgttcttcttcttactacagactgagtacggc
gatatcttcaaggttgacctcgaacacagtaatgacactgttactgagctcaggatcaag
tactttgacaccatacctgtgacatctgctatctgtgtgctgcgctcaggttttctcttt
gctgcttctgagtttggcaaccatgcactttatcagttccgtgatattgggcgggatgtg
gatgttgagtcgtcttcagctacactgatggagacagatgaggggttccagcccgtattc
tttcagccaagagcactcaagaacctgtaccggatcgatgaaattgaaagtctcatgcca
atcatggacatgcgtgttgcaaatctatttgatgaggaaacaccacaggtattcacagcc
tgcggccgtggtcctcggtccaccttgcgcatcctgaggcctgggcttgccattagtgag
atggctcgatcgatgttgccggctgagcctattgctgtctggactgtaaagaagaatatc
aatgacatgtttgatgcctacattgtcgtgtcctttgccaatgttacacttgtgctctcc
atcggtgagactattgaggaagtcagcgacagccagtttctggataccactcactccctg
gcagtttctctccttggcgaggactctctcatgcaggtccacccgaacggcatcaggcac
atcagggaagatggccgtgtgaatgagtggaggacacctgggaagaaaactatcactaag
gttggatcaaaccggctccaggtggtaatcgccctcagtggtggagagcttatctacttt
gagatggacatgacaggtcagcttatggaagtcgagaagcaggacatgtctggtgatgtt
gcatgcctggccattgcgccagttccagaggggagacagaggtcccgattccttgcagtt
ggttcctttgataacaccatccgaatactctccgtggaccctgatgactgcttgcagcct
ctgagtgtccaaagtgtctcttcagccccagagtccctcatgtttctagaagttcaggca
tcagttggcggtgaggacggtgcggaccatccagccaaccttttcctcaatgctggcctg
caaaatggtgtcctgttccgcaccaatgttgacatggtcactggtcagttatctgacaca
cgatctcggttccttggcctgagacctccaaaactgtttccgtgcatagttagccaccgg
caagcaatgctttgcctgtccagccgtccctggcttggctacatacatcaaggtcacttc
ctattgactccactgtcctgtgatacacttgaatctgctgcatccttctcttctgatcag
tgctcagaaggtgttgttgccgttgctggtgatgccctacgaattttcaccattgaacac
ctgggggagactttcaatgaaacagccatccctctgcgctacaccccaagaaaatttgtg
attcttccaaaaaagaaataccttgctgtcattgagagtgataaaggtgcgctcagcgca
gaagagcgagaagcggctaagaaggagtgccttgaggctgctggtgttacagaaaatggt
aatgcaaataatggggatcagatggagaatggtgatggtcaagaagatggtgctgaggac
agaaacacacttccagatgaacagtatggttatccaaaggcggaatcagaaaggtgggtt
tcttgcatcaggattcttgatccaaagagcagagacacgacttgtctgcttgaattgcaa
gacaatgaagcagctgttagcatttgcactgtgaactttcatgataaggagcatggtact
ctcttggctgttggtactgccaagggattgcaattctggccaaagaggaacctttcagct
gggttcatccacatatacaagtttgtagatgaagggaggtcacttgaactgcttcacaag
acacaggtggaggaagtacctcttgccttgtgccagttccaaggacggttgcttgctggt
gttggttcagtcctcaggttatatgatcttgggaagaggaagttgctcaggaagtgtgaa
aacaaacttttcccaaggacgatagtgtctatccatacttaccgagataggatctatgtt
ggtgatatgcaagagtcatttcattattgcaagtacagaagggatgaaaaccaactgtac
atcttcgctgatgatagtgttcccaggtggctcacagcagcaaatcacatagattttgat
actatggcaggggcagataagtttgggaacatatattttgctcgccttcctcaggatctc
tcagatgagattgaagaagacccaactggggggaagattaaatgggagcaagggaagttg
aatggggccccaaacaaagtagaggagattgttcagtttcatgttggtgatgttgtcaca
tgtttgcagaaagcctctttaataccgggaggcggcgaatgtcttatttatgggactgtg
atgggcagtgttggggcactgcttgcattcacctccagggaagatgttgacttcttttct
cacttggagatgcatctccgccaggagcatccaccattatgtggaagagatcacatggcc
tacagatctgcttattttccagtgaaggatgtgattgatggtgacctctgtgagcagttt
ccatccctcccagctgatatgcaaaggaagattgccgatgaactcgacagaactcctggt
gaaatcctgaagaagctggaggacattaggaacaaaattatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328284
Entry
4328284           CDS       T01015                                 
Name
(RefSeq) splicing factor 3B subunit 1 isoform X1
  KO
K12828  splicing factor 3B subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4328284
   03036 Chromosome and associated proteins [BR:osa03036]
    4328284
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4328284
 Complex B
    4328284
 Complex C
   U2 SnRNP specific factors
    4328284
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    4328284
SSDB
Motif
Pfam: SF3b1 HEAT HEAT_2 Cnd1 Vac14_Fab1_bd Adaptin_N IFRD UNC45-central
Other DBs
NCBI-GeneID: 4328284
NCBI-ProteinID: XP_015625355
LinkDB
Position
2:2545921..2551224
AA seq 1283 aa
MDAIDAELARAQEERKKMEEALAAGAPMAVSSVTFDTDLYGGGGSDPNRFAGYDTSIPAS
EDDAPEDDSEAAVNPAARRLASYTGHAVAAADIPRAAEDDGLPKKSQRIIDREDDYRRRR
LARIISPERHDPFAAGEATPDPSVRTYADAMRENDLQKQKEQLLRDIAQKKKEEEEKAKE
KKAVPEQQPVAAPKRRNRWDQSQDGDASAAAGSKKAKTSSDWDAPDATPGIGRWDATPGR
VGDATPSVRRNRWDETPTPGRMADADATPAAGGITPGATPSGAWDATPKLPGGLVTPTPK
KQRSRWDETPASMGSATPGGTGAATPAGYTPGPTPFGGDNLATPTPGQIASRGPMTPEQY
QLLRWERDIEERNRPLTDEELDTMFPQEGYKILEPPASYQPIRTPARKLLATPTPLGTPL
YAIPEENRGQQFDVPKELPGGLPLMKPEDYQYFGTLLNEEEEEQLSPEEQKERKIMKLLL
KVKNGTPPQRKTALRQLTDKAREFGAGPLFNKILPLLMQPTLEDQERHLLVKVIDRVLYK
LDELVRPFVHKILVVIEPLLIDEDYYARVEGREIISNLSKAAGLATMIAAMRPDIDNIDE
YVRNTTARAFSVVASALGIPALLPFLKAVCQSKKSWQARHTGIKIVQQIAILMGCAVLPH
LKSLVEIIEHGLSDENQKVRTITALSLAALAEAAAPYGIESFDTVLKPLWKGIRSHRGKV
LAAFLKAIGFIIPLMDALYASYYTKEVMQILIREFQSPDEEMKKIVLKVVKQCVSTEGVE
ADYIRNDILPEFFRHFWVRRMALDRRNYKQLVETTVEMANKVGVADIVGRIVEDLKDESE
PYRRMVMETIEKVVANLGASDIDARLEELLIDGILYAFQEQTSDDANVMLNGFGAVVNAL
GQRVKPYLPQICGTIKWRLNNKSAKVRQQAADLISRIAIVMKQCQEEQLMGHLGVVLYEY
LGEEYPEVLGSILGALKAIVNVIGMTKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGR
IADRGAEFVPAREWMRICFELLEMLKAHKKGIRRATVNTFGYIAKAIGPQDVLATLLNNL
KVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEM
GKDYIYAVTPLLEDALMDRDLVHRQTAASAVKHMALGVAGLGCEDALVHLLNYVWPNIFE
TSPHVINAVMEAIEGMRVALGPAVILNYCLQGLFHPARKVREVYWKIYNSLYIGAQDALV
AAYPALDDDGDNIYSRPELAMFV
NT seq 3852 nt   +upstreamnt  +downstreamnt
atggacgccatcgacgcggagctcgcgcgggcgcaggaggagcgcaagaagatggaggag
gcccttgccgccggcgcgcccatggccgtctcctccgtcaccttcgacaccgatctctac
ggcggcggcggctccgaccccaaccgcttcgccggctacgacacctccatccccgcctcc
gaggacgacgcgcccgaggacgactccgaggcggccgtcaaccccgccgcccgccgcctc
gcctcctacaccggccacgccgtcgccgccgccgacatcccccgcgccgccgaggacgac
ggcctccccaagaagtcgcagcgcatcatcgaccgcgaggatgactatcgccgccgccgg
ctggcccgcatcatctcgccggagcgccatgatcccttcgccgccggtgaggccaccccg
gacccttccgtgcggacctatgccgatgccatgcgcgagaatgacctgcagaagcagaag
gagcagctgctgcgtgacatagctcagaagaagaaggaagaggaggagaaggccaaggag
aagaaggccgtgcccgagcagcagccagtggcagcgccgaagcgccgcaatagatgggat
cagtcgcaggatggtgatgcttctgctgctgctggatccaagaaggcgaagacctcctcc
gattgggatgctcctgatgcaactcctgggattgggcgctgggatgccacccctggtcgt
gtcggggatgcgacaccgtcggtgagaaggaatcgttgggatgagacaccaactcctggg
aggatggccgatgcggatgcaacacctgcagctggtggcattactccaggtgccacacct
tctggagcttgggatgctactcctaagctgcctggtgggcttgtcacgccaacacccaag
aagcagagatcgagatgggatgagactcctgcaagtatgggtagtgctacacctggaggc
actggtgctgcgacgcctgcaggttacactcctggtccgacgccatttggtggtgacaac
cttgcgacgccaacacccggccagattgcttctcgtggtccaatgactccagagcagtac
cagctcttgcggtgggagcgggacattgaggagcggaacaggcctcttacggatgaggag
cttgatactatgttcccgcaggaagggtacaagattcttgaacctccagcttcataccaa
cccatacgcacaccagcaagaaagctgctcgctacaccaacaccattgggcacaccattg
tatgctattcctgaggagaatcgtgggcagcagtttgatgtgcccaaggagttgcctggt
gggttgcccctcatgaagccagaggattaccagtactttggaacattgctgaatgaggag
gaggaggagcagctatctccagaagagcagaaggagaggaagatcatgaagctcctgctc
aaggtgaagaatggcacacccccacagcggaagacagcacttcgacaactgacagacaaa
gcaagggaatttggtgctggcccattgttcaacaagattctacccttgctcatgcagcca
acacttgaggaccaggagcggcatcttctggtgaaggtcattgacagggtactgtataag
ctggatgagctagtccgtccgtttgtgcataagattcttgtggtcattgagccacttctg
attgatgaggactactatgctcgtgttgagggccgggagattatctcaaatcttagcaaa
gctgctggtcttgctaccatgattgccgccatgagaccagatattgataacattgatgag
tatgtgagaaataccactgctagagcatttagcgtggtggcttctgctttgggtatccct
gctctcctgccattcttaaaggctgtctgtcagagtaagaagtcctggcaagctcggcac
actggtatcaagattgttcagcagattgctattcttatgggctgcgctgttctgccacat
ctcaagtccctagttgagatcattgagcatggtcttagtgacgagaaccagaaagtgcgg
acaatcactgccctttctcttgctgcacttgctgaggctgctgcaccatatggtatagaa
agttttgatactgttttgaagcctctgtggaagggtatcagatctcaccgtggaaaggtt
cttgctgccttcttgaaagctattggtttcatcatccctcttatggatgcgctgtatgcc
agttactacacgaaggaggtcatgcaaatcctgattagggagttccagtcaccagatgaa
gagatgaagaagattgtcctgaaggttgttaaacagtgtgtcagtacagagggtgtagag
gctgattatatccggaatgacatccttcctgagtttttccgtcacttctgggttaggaga
atggctctggaccgcaggaactataagcagcttgtggaaacaacggtagagatggcaaat
aaggttggagttgctgatattgttgggaggattgttgaggatctgaaagatgaaagcgag
ccttacaggagaatggtgatggaaacaattgagaaggttgtggctaatttgggtgcttca
gatattgatgctcgtttggaggagctgcttattgatggcatcctgtatgctttccaagag
cagacaagtgatgatgcaaatgtcatgcttaatggttttggagctgttgtcaatgcactg
ggacagagggtcaagccttaccttcctcagatttgtggtaccattaagtggcggttgaac
aacaagagtgcaaaagttaggcaacaagctgctgatctgatctcgaggatagctattgtg
atgaaacagtgtcaggaggagcagcttatgggtcatttgggtgttgtgctgtatgagtat
ttgggagaagagtaccctgaggtgttgggttcgattcttggagcattgaaagctattgtg
aatgtcattggtatgactaagatgacaccgccaatcaaggatcttcttcctcggctgact
cctatcttgaagaataggcatgagaaggtccaggagaactgcattgatctagttggtagg
attgctgatcgtggagcagaatttgtgcctgctagggagtggatgaggatttgttttgag
cttcttgaaatgttgaaggctcacaagaagggtattagaagagccaccgtgaacacattt
ggttatattgcgaaggctattgggccgcaggatgtgttggctactctgttgaataacttg
aaggtgcaggaacggcaaaaccgtgtctgcacaactgtcgcaattgccattgttgctgaa
acctgctcaccttttacggttctgcctgccctgatgaatgagtaccgagtcccagaactc
aatgttcagaatggtgtcctgaagtctctctctttcctctttgagtatattggtgagatg
ggcaaggattacatatatgctgttactcccttgcttgaagatgctctaatggacagagat
cttgttcaccggcaaactgctgcctctgctgtgaagcacatggctcttggtgttgctggc
ttgggctgtgaggatgctcttgtccatttgcttaactatgtctggccaaacatatttgag
acatctccccatgtcatcaatgctgtcatggaggcgattgaggggatgagagttgctctt
ggtccagctgtgatcttgaattactgccttcaaggccttttccatccagcaaggaaagta
cgtgaagtatattggaaaatctacaactcactatatattggtgcacaagatgcgcttgtt
gctgcttatcctgcactggatgacgatggggataatatctacagccgtccagagctggcg
atgtttgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331222
Entry
4331222           CDS       T01015                                 
Name
(RefSeq) splicing factor 3B subunit 2
  KO
K12829  splicing factor 3B subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4331222
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4331222
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4331222
 Complex B
    4331222
 Complex C
   U2 SnRNP specific factors
    4331222
SSDB
Motif
Pfam: DUF382 PSP
Other DBs
NCBI-GeneID: 4331222
NCBI-ProteinID: XP_015625558
UniProt: A3ACX4 Q6K7Q7
LinkDB
Position
2:35553855..35558836
AA seq 582 aa
MAAAAEVDAAPDLPNGSSATATTDKKKSRESERRRRRRKQKKNKAASNAADADAAGDAGA
DDDAAEEKPDVKPQVEVEVEYVPEQADLDDGLLADFKSIFDKFTFKDSSADAEDDEKKDE
AGTDAAKKAAGSDSDDDEQGTQQKKEGGLSNKQKKLQRRMKIAELKQICNRPDVVEVWDA
TASDPSLLVYLKSYRNTVPVPRHWCQKRKFLQGKRGIEKQPFQLPDFIAATGIEKIRQAY
IEKEDSKKLKQKQRERMQPKMGKMDIDYQVLHDAFFKYQTKPKLTSHGDLYYEGKEFEVK
LREMKPGMLSRELKEALGMPDGAPPPWLINMQRYGPPPSYPQLKIPGLNAPIPPGASFGY
RPGEWGKPPVDEHGRPLYGDVFGVLQQDEPNYDEEPVDRSKHWGDLEEEEEEEEEEEEEE
EEEPMEDEDMEDGMQSVDTISSTPTGVETPDVIDLRKLQRKEPEKQTEKQLYQILEQKEE
RIAPGAIYGSSHTYAIGAQDKAGPKRVDLLKNQKSDKVDVTIQPEELEVMDDVLAAKYEE
AREEEKLRNQKEDFSDMVAENASKRKRKQEKDGKSKKKDFKF
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgaggtcgacgcggcccccgacctccccaacggatcctccgccacc
gccacaaccgacaagaagaagtcgcgggagagcgagcgccgccgccgccgccgcaagcag
aagaagaacaaggccgcgtccaacgccgcagatgcggatgcggccggggacgccggggcc
gacgacgacgccgccgaggagaagcctgatgtcaaaccccaggtggaggtggaggtggag
tacgtcccggagcaggcggacctggacgacggcctcctcgccgacttcaagagcatcttc
gacaagttcaccttcaaggattcctctgccgacgccgaggatgacgagaagaaagatgag
gctggcactgatgccgcaaagaaggctgcagggtctgattcggacgacgacgagcagggg
acacagcaaaagaaggaagggggcttgtccaacaagcaaaagaaactacaacgaaggatg
aagattgcagaactgaaacagatatgcaatagacctgatgttgtggaggtctgggatgca
acggcatcggatccatcattacttgtctatctgaagtcctacaggaacactgtacctgtc
ccaaggcattggtgtcaaaagcgcaaattcttgcagggtaagcgaggtatcgagaaacaa
ccttttcaactccctgacttcatcgctgcaactggaatagaaaaaataagacaggcatat
attgagaaggaggatagtaaaaagttgaaacaaaagcagcgggagcgtatgcaaccaaaa
atgggcaagatggatatagattatcaggtcttgcatgacgccttcttcaaataccaaaca
aagccaaaattgactagtcatggtgacctgtattatgaagggaaagagtttgaggtcaag
cttagggaaatgaagccaggcatgctgtcgcgagaacttaaagaggctcttggtatgcct
gatggtgcgccacctccatggcttataaacatgcagagatatggtcctccgccctcttat
cctcagctgaagattcctgggctaaatgctccgattcctcctggtgctagcttcggatac
cgacctggggaatggggaaaacctcctgttgatgagcatgggcgccccttatatggagat
gtttttggagtcctacagcaggatgaacctaattatgatgaagaacctgttgatcgcagc
aagcactggggagacttggaggaggaagaggaggaggaggaagaagaggaggaagaggag
gaagaagagccaatggaagatgaagacatggaagacggcatgcaatctgttgacaccatc
tcaagcactccaactggtgtggaaacacctgatgtgattgatcttcggaagctgcagcgg
aaagagcctgaaaagcagaccgagaagcaactataccagattcttgagcaaaaagaagaa
agaattgctcctggggctatctatggatcaagccatacgtatgcgattggtgcacaggat
aaggctggtcctaaaagggtggatcttctcaagaatcagaagtctgataaggtggatgtc
accatacaacctgaggagcttgaagttatggatgatgttttggctgccaagtacgaggaa
gcccgggaggaggagaagctacggaaccagaaggaagatttcagcgacatggtggcggag
aacgcaagcaagaggaagaggaagcaggagaaggacgggaagtcgaagaagaaagacttc
aagttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332617
Entry
4332617           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 24
  KO
K12835  ATP-dependent RNA helicase DDX42 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332617
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332617
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4332617
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4332617
 Complex B
    4332617
 Complex C
   U2 SnRNP specific factors
    4332617
SSDB
Motif
Pfam: DEAD Helicase_C ResIII SNF2-rel_dom
Other DBs
NCBI-GeneID: 4332617
NCBI-ProteinID: XP_015633092
UniProt: Q10MH8
LinkDB
Position
3:10984213..10988370
AA seq 770 aa
MSKRPKLGGFSIPRPTSYSFERSQPPQRLYVPADDPDLDDIAFSDDAAAPSDAPPAGGGG
AAGDEEEIDPLDAFMAEIQEEIRAPPPAPKPEALRRADSDDEDDPVESFLRAKKDSGLAL
AADAMHAGYDSDEEVYAAAKAVDAGMMEYDSDDNPIVVDKKKIEPIPPLDHSTIEYEPFN
KDFYEEKPSVSGMSEQEVADYMKSLAIRVSGFDVPRPIKSFADCGFPVQLMNAIAKQGYE
KPTTIQCQALPIVLSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELEKEEGPIGVVCAP
TRELAHQIYLEAKKFAKPYNLRVAAVYGGVSKFDQFKELKAGCEIVIATPGRLIDLLKMK
ALKMFRATYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPYKVERLAREILT
DPIRVTVGQVGSANEDIKQVVNVLPSDAEKMPWLLEKLPGMIDDGDVLVFAAKKARVDEI
ESQLNQRGFRIAALHGDKDQASRMETLQKFKSGVYHVLVATDVAARGLDIKSIKTVVNFD
IAKEMDMHIHRIGRTGRAGDKDGTAYTLITQKEVRFAGELVHCLIAAGQDVPNELMDLAM
KDGRFRANRDSRKGGKKSGKGKGGGGGGGGGSGARGRGRGVRGVDFGLGIGYNAESGSVP
APRSAALNSLKTGMMQNFKSSFVSASSSNTPSNSAPSRGAPSSFVRPALRGFVSGGTIGG
DANQARAVLPAPSFVPASRPAENTVENANPNPESSRDRTRERKRPSGWDR
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgtcgaagcggcccaagctcgggggattcagcatccctcgccccacttcctacagcttc
gagcgctcccagcctccccagcgcctctacgtccccgccgacgaccccgacctcgacgac
atcgccttctccgacgacgcggcggccccgtcggacgcgccccccgcggggggaggcggg
gcggcgggggatgaggaggagatcgacccgctcgacgccttcatggccgagatccaggag
gagattcgcgcgccgccgccggcgcccaagcccgaggcgctccggcgcgcggactccgac
gacgaggacgaccccgtggagagcttcctccgggccaagaaggattccgggctcgcgctc
gccgccgacgccatgcacgccgggtacgactccgacgaggaggtctacgctgcggccaag
gccgtggacgccggcatgatggagtacgactccgacgacaaccccatagtggtggacaag
aagaagatcgagcctattccgccgctcgaccattccaccatcgagtatgaacccttcaac
aaggatttctacgaggagaagccctcggtttcagggatgagtgagcaagaggtggctgat
tatatgaaaagtttggcaattcgagtttcaggttttgatgtgccaagaccaatcaaaagc
tttgcagattgtgggtttcctgtacaactaatgaatgccattgccaagcagggttatgaa
aaaccaactacaatccagtgccaggctttaccaattgtactttcaggcagagatatcatt
ggtattgctaaaactggttctggcaaaactgcagcttttgtactccccatgattgttcac
attatggatcagcctgagcttgagaaagaagaagggccaataggtgtggtatgtgctcca
acaagagaattggcacatcagatataccttgaagctaagaagtttgccaaaccttacaat
cttcgagttgctgctgtatatggtggggtttccaaatttgatcaattcaaagaactgaag
gcaggctgtgaaatagtcattgctaccccagggagattaatagacttgcttaagatgaag
gcattgaagatgtttagggcaacttatttggttcttgatgaagctgatcgcatgttcgat
cttggatttgagcctcagataagatccatcgttggtcaaattagaccagaccgacaaacc
ttgcttttctcagcaacaatgccatacaaagtggaacgtttggctagagaaattttgact
gaccctattagagttacagtaggtcaggttggcagtgctaatgaagacattaagcaagtt
gtaaatgtactcccttctgatgctgagaagatgccttggcttctggaaaaacttcctggg
atgattgatgatggagacgttcttgtatttgcagctaagaaggccagagttgatgagatt
gagagccagttaaatcagagaggtttcagaattgcagcacttcatggtgacaaggatcaa
gcttctcgcatggagacattgcagaagttcaaatccggggtttatcacgtcctagtagca
actgatgttgctgcacgtggtctggacattaagtcgattaaaacagttgttaatttcgat
attgcaaaagaaatggatatgcatattcaccggataggaagaactggccgtgctggtgat
aaagatggaactgcatatactctgattacacagaaggaggtgcgctttgcaggtgaattg
gttcattgtttgattgctgcaggacaggatgtgccaaatgaactaatggatctggcaatg
aaggatggaagattcagagcaaaccgggattcaagaaaaggtgggaagaaaagtggcaaa
ggaaaaggtggaggaggcgggggtggcggcggtagcggtgcccgtggtcgtgggcgtggt
gtacgtggggttgactttggccttggcatagggtacaatgctgaatcaggatcggtgcct
gctccaagatctgctgcattaaattcattgaagacagggatgatgcaaaattttaagagc
agctttgtctctgcctcttcatcaaatacaccaagcaacagcgcaccttcaagaggtgct
ccttcctcctttgtgagaccggcactccgtggttttgtttctggtggcaccataggagga
gacgcaaaccaagcacgggcagtactgcctgcgccctcctttgtccctgcttccagacct
gcagaaaacactgttgaaaatgcgaacccaaaccctgaaagctcgagggatcgcacgagg
gagagaaagcggccgtcggggtgggatcgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334543
Entry
4334543           CDS       T01015                                 
Name
(RefSeq) splicing factor 3B subunit 6-like protein
  KO
K12833  pre-mRNA branch site protein p14
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4334543
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4334543
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4334543
 Complex B
    4334543
 Complex C
   U2 SnRNP specific factors
    4334543
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7 Ribosomal_S17_N
Other DBs
NCBI-GeneID: 4334543
NCBI-ProteinID: XP_015631922
UniProt: B9F6X3 Q7XZG6
LinkDB
Position
3:33998795..33999573
AA seq 130 aa
MAAVSLRKSNARLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIRQIRLGNAKDTRGTA
FVVYEDIYDAKNAVDHLSGFNVANRYLIVLYYQPAKMSKKSDVKKKEEEITRLQEKYGLG
SKTPSSAPDA
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcggcggtgagcttgaggaagagcaacgcgaggctgccgccggaggtgaacagggtg
ctgtacgtgcggaacctgccgttcaacatctcgagcgaggagatgtacgacatcttcggc
aagtacggcgcgatccggcagatccggctggggaacgccaaggacaccaggggcacggcc
ttcgtcgtctacgaggacatctacgacgccaagaacgccgtcgaccacctctccggcttc
aacgtcgccaaccgctacctcatcgtgctctactaccagccggccaagatgtccaagaag
tcggacgtcaagaagaaggaggaggagatcaccaggctgcaggagaagtatggcctcggc
tccaagacgccttcatccgcccccgacgcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337303
Entry
4337303           CDS       T01015                                 
Name
(RefSeq) PHD finger-like domain-containing protein 5B
  KO
K12834  PHD finger-like domain-containing protein 5A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4337303
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4337303
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4337303
 Complex B
    4337303
 Complex C
   U2 SnRNP specific factors
    4337303
SSDB
Motif
Pfam: PHF5 PolC_DP2 CbiC
Other DBs
NCBI-GeneID: 4337303
NCBI-ProteinID: XP_015636282
UniProt: A0A0P0WG29 Q7XM15
LinkDB
Position
4:complement(33854463..33856550)
AA seq 110 aa
MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVI
CGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR
NT seq 333 nt   +upstreamnt  +downstreamnt
atggcaaagcatcatcctgatctcatcatgtgcaggaagcagcctggcattgctattggt
cgtttgtgcgagaaatgtgatggcaagtgtgtcatctgtgactcgtatgtgcgcccatgt
acgcttgtccgagtctgtgatgagtgcaactatggttccttccaggggaggtgtgtcatc
tgtgggggggtcggcatctcagatgcctactactgcaaggagtgcactcagcaggaaaag
gaccgagatggatgtcccaagattgtcaatcttggaagcgccaagaccgatctcttctat
gaacgaaagaagtatggttttaagaagagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338563
Entry
4338563           CDS       T01015                                 
Name
(RefSeq) PHD finger-like domain-containing protein 5B
  KO
K12834  PHD finger-like domain-containing protein 5A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4338563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4338563
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4338563
 Complex B
    4338563
 Complex C
   U2 SnRNP specific factors
    4338563
SSDB
Motif
Pfam: PHF5 PolC_DP2 CbiC
Other DBs
NCBI-GeneID: 4338563
NCBI-ProteinID: XP_015637916
UniProt: A0A0P0WG29 Q7XM15
LinkDB
Position
5:complement(17626778..17629139)
AA seq 110 aa
MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVI
CGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR
NT seq 333 nt   +upstreamnt  +downstreamnt
atggcaaagcatcatcctgatctcatcatgtgcaggaagcagcctggcattgcgattggt
cgtttatgtgagaaatgtgatggcaagtgtgtcatctgtgactcctacgtgcgcccgtgt
acgcttgttcgggtctgtgatgagtgcaactatggatccttccagggaaggtgtgttatc
tgtggaggggttggcatctcagatgcttactactgcaaggagtgcactcagcaagaaaag
gaccgagatggatgtcctaagattgtcaaccttggaagcgccaagaccgatctcttctat
gagcgcaagaaatatggttttaagaagagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338860
Entry
4338860           CDS       T01015                                 
Name
(RefSeq) splicing factor 3B subunit 4
  KO
K12831  splicing factor 3B subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4338860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4338860
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4338860
 Complex B
    4338860
 Complex C
   U2 SnRNP specific factors
    4338860
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 4338860
NCBI-ProteinID: XP_015639933
UniProt: A0A8J8Y7X5 Q0DI02
LinkDB
Position
5:complement(20948224..20951378)
AA seq 187 aa
MSRNPGCTVFIGNLDEKVPERVLYEILIQVGRVVDLHIPRDKETNRSKGYAFAEYETEEI
AQYAVKLFSGLVRLHNRTLRFAISGQDKQSSNGNIPVTPKVNPIPPPKPAQLMRSSDTPA
SQHTVVNGRIAGISPNHSYSAHSEAPSGISSRGLSNGTYEYSRRVFGSVLNDVSRRTDRQ
PIPYPSY
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtcgaggaatccgggctgcaccgtcttcataggtaacttggatgaaaaggtacctgag
agggtcttgtatgagattcttattcaggtaggtcgtgttgtagacctacacataccacgt
gacaaggaaactaatcgctccaaaggttatgcttttgctgagtatgaaacagaggagatt
gcccagtatgctgttaagctattttctggccttgttcgtcttcataatagaacacttaga
tttgcgatttctggacaagacaagcaatcttctaatggaaatattcctgtaacacctaaa
gtgaaccctataccgccaccaaagccggctcagctaatgagatctagtgatactcccgca
tcgcaacatacagtggtaaatggcaggattgctggtatttctccaaaccattcttatagt
gcgcactctgaggcaccaagtgggatatcgagtagaggattaagcaatggtacatacgaa
tatagtagacgcgtatttggttctgttctgaatgacgttagccgtcgtactgacaggcaa
ccaattccatacccgtcctactag

DBGET integrated database retrieval system