KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277488
Entry
107277488         CDS       T01015                                 
Name
(RefSeq) phospholipase D zeta 1-like isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107277488
   00565 Ether lipid metabolism
    107277488
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107277488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107277488
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     107277488
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107277488
 Endosome - Golgi transport
  Others
   Others
    107277488
SSDB
Motif
Pfam: PLDc PLDc_2 PH PH_9 PH_8
Other DBs
NCBI-GeneID: 107277488
NCBI-ProteinID: XP_015640453
LinkDB
Position
5:complement(17051352..17062724)
AA seq 1136 aa
MNVERLVPGGAGGGGGRFRYERMPARGPADDGEGEEEEEEAAVPERRPEVLAASASFRLS
EAARVFEELPRASIVAVSRPDAGDITPMLLSYTIEVHYKQFRWRLYKKASQVLYLHFALK
RREFLEEFHEKQEQVKEWLQNLGIGEHMPVGHDEDEADDVNVPAQAEENSIRHRNVPSSA
VLPVIRPALGRQHSVSDRAKVAMQEYLNHFLGNLDIVNSPEVCKFLEVSCLSFLPEYGPK
LKEDYVSVGHLPKIQKDHKENCCSCGLFSCCKSSWQKVWVVLKPGFLALLKDPFDPKLLD
VLIFDALPHMDISGEGQISLAKEIKERNPLHFGLQVSSGGQTLKLRTRSSSKVKDWVSAI
NAARQTPEGWCYPHRFGSFAPPRGLMPDGSMVQWFIDGEAAFQAIASSIEQAKSEIFITG
WWLCPELFLRRPFQHHGSSRLDALLEARAKQGVQIYILLYKEVALALKINSLYSKQKLLN
IHENVKVLRYPDHFSSGVYLWSHHEKIVIVDNQVCYLGGLDLCFGRYDNSAHKLSDVPPV
IWPGKDYYNPRESEPNSWEDTMKDELDRTKYPRMPWHDVQCALYGPPCRDVARHFVQRWN
YAKRNKAPNEQGIPLLMPHHHMVIPHYKGIGQEINSEADGKQNHDKDCDVKKPVSVDSRE
SCQDIPLLLPQELEPPALPNGDLRVNDLDANHSDHLHKTSFNQPLLNRKAKLDSSRQDLP
MRGFVDNISSLESSSIRHFDSSKEEKYHMDKNWWEMQERGDQVASVLDIGQVGPRATCHC
QVIRSVGQWSAGTTQIEGSIHNAYFSLIEKAEHFVYIENQFFISGLSGDETIKNRVLEAL
YRRILRAEREKKRFKAIIIIPLLPGFQGGIDDGGAASVRAIMHWQYRTICRGPNSILQNL
YDVIGPKAHDYISFYGLRAHGRLCEGGPLVTNQIYVHSKLMIIDDRITLIGSANINDRSL
LGSRDSEIAVVIEDKEVVSSKMNGKPWEAGKFSLSLRLSLWAEHLGLHRGEVSHIMDPID
DSTFKNIWMATAKTNTMIYQDVFSCVPNDLIHSRAQFRQSFAHCRDKIGHNTIDLGVAQE
KLETYQDGDLKGTDPIERLQMIKGHLVSFPLDFMSQEDLRPYFSESEYYTSPQVFH
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgaacgtggagcgcctcgtccccggcggcgccggcggcggcggcggccgcttccggtac
gagcggatgccggctaggggcccggcggatgacggggagggggaggaggaggaggaggag
gcggcggtgccggagcggcggccggaggtcctggcggcgtcggcgtcgttccgcctctcg
gaggcggcgcgggtgttcgaggagctccccagggcgtcgatcgtcgccgtgtcgcgcccc
gacgccggggacatcaccccgatgctgctgtcgtacaccatcgaggtgcactacaagcag
tttaggtggcgtctatataagaaagcttcacaagttctctatctacattttgcattgaag
aggcgtgaatttcttgaagaattccatgagaagcaagaacaggtcaaagagtggctccaa
aatctgggaattggggagcacatgccagtaggacatgatgaggatgaagcagacgatgtg
aatgttcctgcacaggctgaagaaaactccattagacatagaaatgttccttcaagtgct
gttttgcctgtcattcgaccagctctggggcgtcaacactcagtttctgatcgagcaaaa
gttgccatgcaagaatatctgaaccattttttggggaacttggacattgtcaactcaccg
gaggtttgcaaatttttggaggtatcatgtttgtcatttttaccggaatatgggcctaag
ctaaaggaagattatgtatctgttggacacttgccaaaaattcagaaggaccataaagaa
aactgttgttcatgtgggttgtttagctgttgcaaaagcagctggcaaaaggtttgggtt
gtcctgaagccaggattcttagctttactcaaagatccttttgatccaaagcttttagat
gtccttatctttgatgcactgccacatatggatataagtggagagggccaaatatctcta
gcaaaagagatcaaggaacgaaacccgttgcatttcggactccaggtgtcttctggtggc
cagactttaaagttacgaacaagaagttcttctaaagtgaaagactgggttagtgcaata
aatgctgctcgacaaactccagagggctggtgttaccctcatcgttttggttcatttgct
ccaccaaggggtctcatgccagatgggagtatggtacagtggtttatagacggagaagct
gcatttcaggcaattgcttcctccattgagcaagcaaaatcagagatatttattactggc
tggtggctctgcccagaattgtttctccgacgccctttccaacatcatgggtcatctagg
cttgatgctctactggaagctagagctaagcagggtgtacagatctacattcttttgtac
aaggaagttgctcttgcattgaaaatcaacagcttgtacagtaaacaaaagctacttaac
attcatgagaatgtaaaagttctgcgatatcctgatcatttctcaagcggtgtatactta
tggtcacaccatgagaaaattgtgatagtagataatcaagtatgctatcttggaggtctt
gatctgtgctttggtcgctacgataattctgcgcacaaactttcagatgttcctcctgtg
atatggccagggaaagactactataaccccagggaatctgagccaaattcctgggaggac
acaatgaaagatgagctggaccgaacgaaatatcctcgcatgccttggcatgatgttcag
tgtgctctctacggtccaccttgtcgggatgttgcaaggcattttgttcagcgctggaat
tatgcaaagaggaacaaagctcccaatgagcaaggaattcccttgctgatgcctcatcac
cacatggtaattccacattacaagggcataggccaagaaattaatagtgaggctgatggt
aaacaaaatcatgacaaggattgtgatgttaaaaaaccagtctctgtggactcacgggag
tcttgtcaggacattccattgcttttacctcaagagcttgaaccaccggcattgcccaat
ggagatttaagagtgaacgatttagacgccaaccactctgatcacctacacaaaacaagc
ttcaatcagcctttgctcaaccggaaggcaaagttggattcttcccgacaggatttgccc
atgagaggtttcgtagacaatataagttcccttgagtcatcatctattaggcattttgat
tcttccaaagaagaaaagtatcacatggataagaactggtgggagatgcaagaaagagga
gatcaagttgcttcagtacttgatatagggcaagttggtccaagggcaacttgtcattgt
caggtaattagaagtgttggtcaatggtcagctggaaccactcaaatcgaaggaagcatc
cacaatgcctatttttctcttattgaaaaggcagaacattttgtatatatcgagaatcaa
tttttcatatcaggcctttcaggagatgaaacgataaaaaatcgtgtattggaagcatta
tacaggcgcatacttcgggcagagagagaaaaaaagcgcttcaaagccatcataataata
cctctgttacctggttttcagggaggcattgatgatggcggagctgcatctgtgagagca
attatgcattggcaataccggactatctgtagaggccctaattctatacttcagaatcta
tatgatgttattggtccaaaagcacatgattatatctcattttatggtcttagagcacat
ggtagactatgcgaaggaggtcccttggtcactaatcagatttatgtccacagtaagttg
atgataattgatgaccgcatcacattgattggatcagctaacataaatgatagaagcttg
cttggatcaagagattctgagattgccgtggtcattgaagataaagaagttgttagttcc
aaaatgaatggaaaaccttgggaagctgggaagttttctctaagcctacgtctctctctc
tgggcagagcaccttggccttcatcgaggagaggtcagccatattatggaccctatcgat
gactcaactttcaaaaatatctggatggccactgctaagacaaataccatgatttaccaa
gatgtcttctcatgtgtacctaatgatcttatccattcaagggcccaatttcggcagagc
tttgctcactgcagggataaaatcggtcacaatacaatcgatttgggggttgcccaagag
aagctggaaacctaccaggacggcgatctcaagggtacggaccctatagaaagattgcag
atgatcaaaggtcaccttgtttctttcccgttggatttcatgtcccaagaggacttgaga
ccatatttcagtgaaagtgaatattatacgtctccacaagttttccattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327647
Entry
4327647           CDS       T01015                                 
Name
(RefSeq) phospholipase D alpha 1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4327647
   00565 Ether lipid metabolism
    4327647
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4327647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327647
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4327647
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4327647
 Endosome - Golgi transport
  Others
   Others
    4327647
SSDB
Motif
Pfam: PLD_C PLDc C2 PLDc_2 MCM_N
Other DBs
NCBI-GeneID: 4327647
NCBI-ProteinID: XP_015646609
UniProt: Q43007
LinkDB
Position
1:complement(3724610..3729279)
AA seq 812 aa
MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL
EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL
LNGEEIDRWLDICDNNREPVGESKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQR
QGCKVTLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDIFDAISNAQHLIYITGWSVYTEI
TLVRDSNRPKPGGDVTLGELLKKKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETEN
YFHGSDVNCVLCPRNPDDSGSIVQDLSISTMFTHHQKIVVVDHELPNQGSQQRRIVSFVG
GLDLCDGRYDTQYHSLFRTLDSTHHDDFHQPNFATASIKKGGPREPWHDIHSRLEGPIAW
DVLYNFEQRWRKQGGKDLLLQLRDLSDTIIPPSPVMFPEDRETWNVQLFRSIDGGAAFGF
PDTPEEAAKAGLVSGKDQIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSYAWKPEGIKP
EDIGALHLIPKELALKVVSKIEAGERFTVYVVVPMWPEGVPESGSVQAILDWQRRTMEMM
YTDITEALQAKGIEANPKDYLTFFCLGNREVKQAGEYQPEEQPEADTDYSRAQEARRFMI
YVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMA
LWYEHLGMLDDVFQRPESLECVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDG
VVTELPGMEYFPDTRARVLGAKSDYMPPILTS
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggcgcagatgctgctccatgggacgctgcacgccaccatcttcgaggcggcgtcgctc
tccaacccgcaccgcgccagcggaagcgcccccaagttcatccgcaagtttgtggagggg
attgaggacactgtgggtgtcggcaaaggcgccaccaaggtgtattctaccattgatctg
gagaaagctcgtgtagggcgaactaggatgataaccaatgagcccatcaaccctcgctgg
tatgagtcgttccacatctattgcgctcatatggcttccaatgtgatcttcactgtcaag
attgataaccctattggggcaacgaatattgggagggcttacctgcctgtccaagagctt
ctcaatggagaggagattgacagatggctcgatatctgtgataataaccgcgagcctgtt
ggtgagagcaagatccatgtgaagcttcagtacttcgatgtttccaaggatcgcaattgg
gcgaggggtgtccgcagtaccaagtatccaggtgttccttacaccttcttctctcagagg
caagggtgcaaagttaccttgtaccaagatgctcatgtcccagacaacttcattccaaag
attccgcttgccgatggcaagaattatgaaccccacagatgctgggaggatatctttgat
gctataagcaatgctcaacatttgatttacatcactggctggtctgtatacactgagatc
accttggttagggactccaatcgtccaaaacctggaggggatgtcacccttggggagttg
ctcaagaagaaggccagtgaaggtgttcgggtcctcatgcttgtgtgggatgacaggact
tcagttggtttgctaaagagggatggcttgatggcaacacatgatgaggaaactgaaaat
tacttccatggctctgacgtgaactgtgttctatgccctcgcaaccctgatgactcaggc
agcattgttcaggatctgtcgatctcaactatgtttacacaccatcagaagatagtagtt
gttgaccatgagttgccaaaccagggctcccaacaaaggaggatagtcagtttcgttggt
ggccttgatctctgtgatggaaggtatgacactcagtaccattctttgtttaggacactc
gacagtacccatcatgatgacttccaccagccaaactttgccactgcatcaatcaaaaag
ggtggacctagagagccatggcatgatattcactcacggctggaagggccaatcgcatgg
gatgttctttacaatttcgagcagagatggagaaagcagggtggtaaggatctccttctg
cagctcagggatctgtctgacactattattccaccttctcctgttatgtttccagaggac
agagaaacatggaatgttcagctatttagatccattgatggtggtgctgcttttgggttc
cctgatacccctgaggaggctgcaaaagctgggcttgtaagcggaaaggatcaaatcatt
gacaggagcatccaggatgcatacatacatgccatccggagggcaaagaacttcatctat
atagagaaccaatacttccttggaagttcctatgcctggaaacccgagggcatcaagcct
gaagacattggtgccctgcatttgattcctaaggagcttgcactgaaagttgtcagtaag
attgaagccggggaacggttcactgtttatgttgtggtgccaatgtggcctgagggtgtt
ccagagagtggatctgttcaggcaatcctggactggcaaaggagaacaatggagatgatg
tacactgacattacagaggctctccaagccaagggaattgaagcgaaccccaaggactac
ctcactttcttctgcttgggtaaccgtgaggtgaagcaggctggggaatatcagcctgaa
gaacaaccagaagctgacactgattacagccgagctcaggaagctaggaggttcatgatc
tatgtccacaccaaaatgatgatagttgacgatgagtacatcatcatcggttctgcaaac
atcaaccagaggtcgatggacggcgctagggactctgagatcgccatgggcgggtaccag
ccataccatctggcgaccaggcaaccagcccgtggccagatccatggcttccggatggcg
ctgtggtacgagcacctgggaatgctggatgatgtgttccagcgccccgagagcctggag
tgtgtgcagaaggtgaacaggatcgcggagaagtactgggacatgtactccagcgacgac
ctccagcaggacctccctggccacctcctcagctaccccattggcgtcgccagcgatggt
gtggtgactgagctgcccgggatggagtactttcctgacacacgggcccgcgtcctcggc
gccaagtcggattacatgccccccatcctcacctcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331421
Entry
4331421           CDS       T01015                                 
Name
(RefSeq) phospholipase D beta 1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4331421
   00565 Ether lipid metabolism
    4331421
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4331421
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331421
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4331421
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4331421
 Endosome - Golgi transport
  Others
   Others
    4331421
SSDB
Motif
Pfam: PLD_C C2 PLDc PLDc_2
Other DBs
NCBI-GeneID: 4331421
NCBI-ProteinID: XP_015629910
UniProt: Q10SL1
LinkDB
Position
3:complement(1027574..1031676)
AA seq 830 aa
MDVVWPHGHGVWGSSSASRRSAMLHGSLDIWIHEARNLPNMDIVSKTVVDILGTKKKKKA
ANGAMTSDPYVTVQLASATVARTYVVNDDENPVWAQHFLIPVAHEAPAVHFLVKDSDVFG
AELIGEVVVPAEQLEAGEHVEGVYPVLDPAAGKPCAPGAVLRLSVQYIPVARLTMYHHGV
TPGPDFAGVPNTYFPLRRGGRVTLYQDAHVPEGSLPEIRLGNGALYRQGQCWHDVYDAIS
QARRLIYITGWSVFHTIQLVRDGGAGVSLGDLLKRKSQEGVRVLLLVWDDPTSRNVLGIQ
MEGYMGTRDEETRRFFKHSSVQILLCPRSAGKRHSWVKQQETGTIFTHHQKTVILDADAG
NHKRKIVAFVGGLDLCGGRYDTPTHPLFRSLQTLHKDDYYNPNFAVLDAQGPREPWHDLH
SKIDGPAAYDVLTNFEERWLKASKRSGVKKLSKANNDTLLWIGRIPDIASIDDEVYSSDN
DPERWDVQIFRSIDSNSVKGFPKNPREATSKNLVCGKNVLIDMSVQTAYVNAIRGAQHFI
YIENQYFLGSSFNWDSHKDVGANNLIPIEIALKIANKIYANERFSAYIVIPMWPEGNPTG
APTQRILYWQKKTMQMMYEVIHKALKEVGLDNTYEPQDYLNFFCLGNREAGGSPSTCRGS
SSANNPQDQAKKNRRFMVYVHSKGMIVDDEYVIIGSANINQRSMEGTRDTEIAMGAYQPQ
YTWANMLSAPRGQIYGYRMSLWAEHIGAVEESFSCPESLECTRQVRHIGEQNWRQFASSE
VSEMRGHLVKYPVSVARDGKVKPLPGCAAFPDLGGNICGTFLPIQENLTI
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggatgtggtgtggccgcacgggcacggcgtctggggctcgtcgtcggcgtcgcggcgg
tcggcgatgctccacggcagccttgacatatggatccacgaggcgcggaacctcccaaac
atggacatcgtctccaagaccgtcgtcgacatcctcgggacgaagaagaagaagaaggcg
gccaacggcgccatgaccagcgacccctacgtcactgtgcagctcgcgtccgccaccgtc
gcgcgcacctacgtcgtcaacgacgacgagaaccccgtgtgggcgcagcacttcctcatc
cccgtcgcgcacgaggcgcccgccgtccacttcctcgtcaaggacagcgacgtcttcggc
gccgagctcatcggcgaggtcgtcgtccccgccgagcagctcgaggccggggagcacgtc
gagggcgtctacccggtcctcgatcccgccgccggcaagccgtgcgcccccggcgccgtg
ctgcggctgtcggtgcagtacatccccgtggcgaggctaaccatgtaccaccacggcgtc
accccgggcccggacttcgccggcgtccccaacacctacttcccgctgcgccgcggcggc
cgggtgacgctgtaccaggacgcgcatgtgccggagggctcgctgccggagatcaggctg
ggcaatggcgcgctctaccggcaaggccaatgctggcacgatgtctacgacgcgatatcg
caggcgaggaggctcatctatatcaccgggtggtcggtgttccacaccattcagcttgtg
cgggacggcggcgccggcgtctcgctgggcgatctgctgaagaggaagtcgcaggagggg
gtgagggtgctgctcctcgtctgggacgatccaacgtcaaggaacgtccttggtatccag
atggaaggttacatgggcacacgggatgaggagacccgtagatttttcaagcattcttca
gttcagatactgctctgcccgcgttctgctgggaaaaggcacagctgggttaagcagcag
gagaccggaaccatttttacacatcatcagaaaacagtgattctggatgctgatgccggc
aaccataaaaggaaaatagttgcttttgttggaggccttgatttatgcggtggacgatat
gatacacctactcatcctctttttcggtctctccagacattgcacaaggacgactattat
aacccaaactttgcggtacttgatgcccaagggccaagagaaccatggcatgatttgcat
tctaagattgatggcccagcggcatatgatgtcttgacaaactttgaggagcgctggtta
aaggcatccaagcgcagcggggttaaaaaattgtcaaaggcaaataatgacacattgcta
tggattggaaggatacctgatattgcaagcattgacgatgaagtgtattcaagtgacaat
gatccagagcgatgggatgttcagatattccggtcaattgattcaaattctgtcaagggt
tttcccaaaaatccaagagaagcaaccagtaagaatctcgtttgtgggaaaaacgtacta
attgatatgagcgtacaaaccgcttatgtgaatgcaatccgaggagctcaacacttcatc
tatattgaaaatcagtatttccttggttcttcatttaattgggattcacataaagatgta
ggtgctaataacttaataccgattgaaatagctctcaaaattgccaacaagatttatgcc
aatgagaggttttcagcgtacatagtaattccaatgtggcctgaaggtaatcctactggt
gctcctacacagagaatactttactggcagaaaaaaacaatgcaaatgatgtatgaggta
attcacaaggcattgaaagaagtagggctggataacacatatgagccacaggattacctg
aacttcttctgtcttggcaatcgtgaagcaggcggcagtcctagcacttgcagaggatca
agttcagccaacaatccccaggatcaagctaagaagaaccggaggttcatggtgtatgtg
cactcgaaagggatgatcgtggatgatgaatacgtgataattggatcggctaacattaac
cagagatccatggaaggaaccagagacaccgagatcgccatgggagcgtaccagccccag
tacacatgggcaaacatgctttctgctcctcgtggacagatctacgggtacaggatgtca
ctgtgggcagagcacattggagcggtggaggaaagcttcagttgcccagagagcctggag
tgcacgaggcaggttcggcacatcggggagcagaactggaggcagttcgcctccagcgag
gtgagcgagatgagagggcacctcgtcaagtaccccgtcagcgtcgcccgcgacggcaag
gtgaagcccctgccgggatgcgccgcgttcccggacctcggcggcaacatctgcggcacg
ttcctgcccatccaagaaaacctcaccatatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333024
Entry
4333024           CDS       T01015                                 
Name
(RefSeq) phospholipase D alpha 1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4333024
   00565 Ether lipid metabolism
    4333024
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4333024
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333024
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4333024
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4333024
 Endosome - Golgi transport
  Others
   Others
    4333024
SSDB
Motif
Pfam: PLDc PLD_C C2 PLDc_2
Other DBs
NCBI-GeneID: 4333024
NCBI-ProteinID: XP_015628879
UniProt: Q10KA3 Q75KP6
LinkDB
Position
3:15672815..15678838
AA seq 851 aa
MARMLLHGVIDAKIVEADLSVTSDGQLRPSRKTLMKKKVFSWIKKKLPFCNSCQTQQVEN
AVGLGPLSGKLYATVDIDKARVARTRTVEPTGTPRWKESFHIYCAHYAGDVIFTVKAENP
VGATLIGRAYLPVDEGLAAGAPVSDLWLPICGEGRRPIDGGDKIRVQLRFTGVAADPAAR
WGAGVGSGAYQGVPRTFFPQRRGCRVRLYQDAHIADGFAPRIQLAGRRWYEPRRCWEDVF
DAISSARRMVYVAGWSVNTDVVLVRRPSSSSETLGELLKRKAEQGVMVLLLVWNDRTSVG
LGPIRRDGLMATHDQDTARYFEGTKVHCVLCPRNPDQGRSYVQDVETATMFTHHQKTVIV
DGGGGKTAPGLVSFLGGIDLCDGRYDTQEHPLFRTLDTTHRGDFHQPNFPGASIAKGGPR
EPWHDIHCRVEGPAAWDVLDNFEQRWRKQAGRGKDSLLVTLDRSMAARDADQADPEHWNV
QVFRSIDGGAAAGFPESPDEAAAAGLVSGKDQVIERSIQDAYIHAIRRARDFIYVENQYF
LGSSYAWRGGKGGVASVEGINALHLVPRELSLKIASKIAAGERFAVYVVVPMWPEGVPES
DSVQAILDWQRRTMEMMYRDVDAAIQAKGIRADPTDYLNFFCLGNRERLPVPGGYSYEPT
ERPDPDTDYMRAQNARRFMIYVHAKTMIVDDEYIIVGSANINQRSMDGGRDTEIAMGAYQ
PSHLASVNRPARGQVHGFRLALWHEHLGRAAAASAAGELLRPSSLASVRLVNQAARRHWD
AFARGDGDGAPPTEDLPGHLMAYPVRWTGCGGSDGSDGSDGKLVAATETFPDTKAKVLGA
KSDVLPPILTT
NT seq 2556 nt   +upstreamnt  +downstreamnt
atggcacggatgctgctgcacggggtgatcgacgccaagatcgtggaagcagacctgtcc
gtgacgtcagatgggcagctcaggccgtcccggaagactctgatgaagaagaaggtcttc
tcatggatcaagaagaagctgcccttctgcaacagctgccagacgcagcaggtggagaac
gccgtcggcctcggcccgctgtccggcaagctgtatgcgacggtggacatcgacaaggcc
cgcgtcgcgcggacgcgcacggtggagccgacgggcacgccgcggtggaaggagtcgttc
cacatctactgcgcgcactacgccggcgacgtcatcttcaccgtcaaggccgagaacccc
gtcggcgccacgctcatcggccgcgcctacctccccgtcgacgagggcctcgccgccggt
gcgccggtgtccgacctgtggctccccatctgcggcgagggccgccgcccgatcgacggc
ggggacaagatacgcgtccagctccggttcaccggcgtcgccgccgacccggcggcgcgc
tggggcgccggcgtcgggagcggcgcgtaccagggcgtgccgcgcaccttcttcccgcag
cgccgcgggtgccgcgtcaggctgtaccaggacgcgcacatcgccgacggcttcgcgccg
cgcatccagctcgccgggcgcaggtggtacgagccgcggcggtgctgggaggacgtgttc
gacgcgatcagcagcgcccggaggatggtgtacgtcgccgggtggtccgtcaacaccgac
gtcgtgctggtgcggcggccgtcgtcgtcgtcggagacgctcggcgagctgctcaagagg
aaggccgagcagggcgtgatggtgctgctgctggtgtggaacgaccggacgtcggtgggt
ctcggcccgatccgccgcgacgggctgatggcgacgcacgaccaggacacggcgaggtac
ttcgagggcaccaaggtccactgcgtcctctgcccccggaaccccgaccagggccggagc
tacgtgcaggacgtcgagacggccaccatgttcacgcaccaccagaagacggtgatcgtc
gacggcggcggcgggaagacggcgccgggcctcgtgagcttcctcggcggcatcgacctg
tgcgacgggaggtacgacacgcaggagcacccgctgttccggacgctcgacaccacccac
cgcggcgacttccaccagcccaacttccccggcgcgtccatcgccaagggcgggccgagg
gagccatggcacgacatccactgccgcgtcgagggccccgcggcctgggacgtgctcgac
aacttcgagcagcggtggcgcaagcaggccggcaggggcaaggacagccttctggtcacc
ctcgaccggagcatggccgcgcgcgacgccgaccaggccgacccggagcactggaacgtg
caggtgttccgctccatcgacggcggcgcggcggcggggttcccggagagccccgacgag
gccgcggcggcggggctggtgtccggcaaggaccaggtgatcgagcgcagcatccaggac
gcgtacatccacgcgatccggcgcgcccgcgacttcatctacgtcgagaaccagtacttc
ctggggagctcgtacgcgtggcgcggcggcaagggcggcgtggcgagcgtggaggggatc
aacgcgctgcacctggtcccgagggagctctccctcaagatcgcgagcaagatcgccgcc
ggcgagcggttcgccgtgtacgtggtggtgccgatgtggccggagggcgtgccggagagc
gactccgtgcaggccatcctggactggcagcggcgcaccatggagatgatgtacagggac
gtggacgccgccatccaggccaaggggatccgcgccgaccccaccgactacctcaacttc
ttctgcctcggcaaccgcgagcgcctccccgtccccggcgggtacagctacgagccaacg
gagcgccccgaccccgacaccgactacatgagggcgcagaacgcccgccgcttcatgatc
tacgtccacgccaagacgatgatagtggacgacgagtacatcatcgtggggtcggcgaac
atcaaccagaggtcgatggacggcgggcgggacacggagatcgcgatgggcgcgtaccag
ccgagccacctggcgtcggtgaaccggccggcgaggggccaggtgcacggcttccgcctc
gcgctgtggcacgagcacctgggcagggcggctgcggcgtcggccgccggcgaactcctc
cggccgtcgagcctggcgagcgtgaggctcgtgaaccaggcggcgcggcgccactgggac
gcgttcgcgagaggcgacggcgacggcgcgccgccgacggaagacctcccgggccacctg
atggcgtacccggtgcgctggacgggctgcggcggcagcgacggcagcgacggcagcgac
ggcaagctcgtcgcggcgacggagacgttcccggacaccaaggcgaaggtgctgggtgcc
aagtctgacgtgctcccgcccatcctcaccacatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334732
Entry
4334732           CDS       T01015                                 
Name
(RefSeq) phospholipase D delta
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4334732
   00565 Ether lipid metabolism
    4334732
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334732
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334732
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4334732
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4334732
 Endosome - Golgi transport
  Others
   Others
    4334732
SSDB
Motif
Pfam: C2 PLD_C PLDc PLDc_2
Other DBs
NCBI-GeneID: 4334732
NCBI-ProteinID: XP_015628056
UniProt: Q6AVR2 Q10AU8
LinkDB
Position
3:complement(35350195..35355468)
AA seq 847 aa
MGKSSADLSASSESAVLLHGDLDIWITEAKCLPNMDIMSERMRRFFTGYGACGSSCGGTG
DNARRAGGGVRPKKIITSDPYVSVCLAGATVAQTRVIPNSENPRWEERFRVEVAHAVSRL
EFHVKDNDVFGAQLIGVASLPVDRILSGAPAEGWFPIDGHCSSNPMRPPPELRLSVQYRP
IDDNPLYRGGAGAVPNAYFPLRRGGGVTLYQDAHVADGGLPAIQIAGGRAYEHGRCWEDI
CHSIVEAHHLVYMVGWSIYHPVKLVREPTRALPGETPSTLGELLKKRAREGVRIVILLWD
DKTSHDKFLLKTDGVMHTHDEETKKFFRHSGVHCVLVPRYASTKLSIFKQQVVGTLFTHH
QKCVLVDTQATGNNRKITAFIGGLDLCDGRYDTPEHRLFKDLDTAFNKDFHNPTFPVNSY
GPRQPWHDLHCKIEGPAAFDILTNFEQRWRKATKWKVNLKKVASWHHDTLIKINRMSWIV
TPAADEANAHVCEEKDPENWHVQVFRSIDSGSVKGFPKIVQEAESQNLVCAKNLKIDKSI
HSAYVKAIRSAQHFIYIENQYFIGSSFLWSSHKSAGADNLIPVELALKIASKIKANEQFA
VYIVLPMWPEGIPTAAPMQQILFWQSQTMSMMYKIIADALQMQGLVEAHPQDYLNFYCLG
KREVAAGDSMSQTSLCNDNSTLRSAQKLRRFMIYVHSKGMVVDDEYVIIGSANINQRSME
GCRDTEIAMGAYQPHYKWSADHGQGPPRGQVYGYRMSLWAEHLGAVEECFGRPETGECVR
RVREMAEENWRAYVSPEMEETKGHLMCYPLKVDKDGRVRSLPGHDCFPDVGGKVLGTQTS
LPNALTT
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggggaaaagctccgccgacttgtccgcctcctcggagtcggccgtgctcctgcacggc
gacctcgacatttggataaccgaggccaagtgcctccccaacatggacatcatgtcggag
cggatgcgccgcttcttcaccggctacggcgcctgcggctcctcgtgcggcggcaccggc
gacaacgcgcgccgggccggcggcggcgtcaggcccaagaagatcatcaccagcgacccc
tacgtctccgtctgcctcgccggcgccaccgtcgcgcagacgcgggtcatccccaactcc
gagaaccccaggtgggaggagcgcttccgcgtcgaggtcgcccacgccgtctccaggctc
gagttccacgtcaaggacaacgacgtcttcggcgcgcagctcatcggcgtcgcctccctc
cccgtcgacaggatcctctccggcgcccccgccgagggctggttccccatcgacggccac
tgcagcagcaaccccatgcggccgccgccggagctccgcctctccgtccagtacaggccc
atcgacgacaaccccctctacaggggcggcgccggcgccgtccccaacgcctacttccct
ctccgccgaggtggcggcgtcaccctctaccaggacgcccacgtcgccgacggcggcctc
ccggccatccagatcgccggcggaagggcgtacgagcacggccgatgctgggaggacatc
tgccactccatcgtggaggcgcaccacctcgtgtacatggtcggatggtccatctaccac
cccgtcaagctcgtcagggagcccacccgggcgctccccggcgagacgccatcgacgctc
ggcgagcttctcaagaaaagggctcgcgagggcgtccgcatcgtcatcttgctctgggac
gacaagacgtcgcatgacaagttccttctcaaaacggatggtgtcatgcatacacacgac
gaggagaccaaaaagtttttcaggcattcaggtgttcactgtgtgctggttcctcgctat
gccagcactaagcttagcattttcaagcagcaggtagtgggaactttatttacacatcat
cagaaatgtgtgcttgttgatacacaagctactgggaacaaccgcaaaatcactgctttc
attggtggtctagacttgtgcgacggcagatacgatacacctgaacataggcttttcaaa
gatcttgataccgctttcaacaaggacttccataatcctacatttcctgttaattcatat
ggaccaagacagccatggcatgatttacactgcaagattgagggccctgctgcctttgat
atactgacaaactttgaacagcggtggagaaaagcaaccaaatggaaggtcaatcttaag
aaagttgcaagttggcatcatgacacgctgataaaaataaaccggatgtcctggattgtt
accccagctgcagatgaggctaatgcacatgtttgtgaagaaaaggacccagaaaattgg
catgtgcaggtgttcaggtcaattgattcaggttctgtaaaggggttcccaaaaattgtt
caggaggcagagtctcagaatcttgtctgtgcaaagaatctaaagatcgacaaaagcata
cacagtgcatatgtcaaagcaatcaggtctgcgcagcacttcatatacattgagaaccag
tatttcattgggtcatcgttcttatggtcctcacataaaagcgcaggtgctgataactta
atacctgtggagctggccttgaagattgcaagcaagatcaaggcaaatgagcagttcgcg
gtgtacattgtcctaccaatgtggcctgaaggcatcccaaccgcggcaccgatgcagcaa
atcctcttttggcagagccaaacaatgtctatgatgtacaagatcatagcggacgctctg
cagatgcagggattggttgaagctcaccctcaagattatctgaatttctactgcctcggc
aagcgcgaggtcgccgccggtgacagcatgtcccagacgagcttatgcaatgacaactcc
actctgcgctcggcacagaagctccggagattcatgatctatgtgcactcgaaagggatg
gtggtggacgacgagtacgtcatcatcggatcggccaacatcaaccagaggtccatggaa
ggctgcagggacaccgagatcgccatgggcgcctaccagccacactacaagtggtctgct
gatcacggccaaggccctcctcgtggacaggtgtacgggtacaggatgtcgctgtgggcg
gagcaccttggggcggtggaggagtgcttcgggcggccggagacgggggagtgcgtgagg
cgggtgagggagatggcggaggagaactggagggcgtacgtgtcgccggagatggaggag
acgaaggggcacctgatgtgttacccgttgaaggtggacaaggacggccgcgtccgctct
ctccccggccacgactgcttccccgacgtcggcggcaaggtcctcggcactcaaacctcg
ctccccaatgccctcaccacctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337942
Entry
4337942           CDS       T01015                                 
Name
(RefSeq) phospholipase D alpha 1-like
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4337942
   00565 Ether lipid metabolism
    4337942
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4337942
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337942
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4337942
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4337942
 Endosome - Golgi transport
  Others
   Others
    4337942
SSDB
Motif
Pfam: PLD_C PLDc C2 PLDc_2
Other DBs
NCBI-GeneID: 4337942
NCBI-ProteinID: XP_015640163
UniProt: Q65XR9 A0A8J8YHE0
LinkDB
Position
5:complement(4255825..4260341)
AA seq 824 aa
MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL
DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV
LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKDRSWGRGVRSGKYPGVPYTF
FSQRQGCKVTLYQDAHVPDGFIPRIPLDGGRSYEPHRCWEDIFDAINGARHFIYITGWSV
YTEIALIRDADRPKPGGGVTLGELLKKKAGEGVRVLMLVWDDRTSVGMLKKDGLMATHDE
ETMNYFQGTEVNCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPSSRHGGGNGG
GRRRVVSFVGGLDLCDGRYDTPFHSLFRTLGTAHHDDFHQPNFATATVAKGGPREPWHDI
HCRLEGPVAWDVLYNFEQRWRKQGGKDLLVQLRDLAETVIPPSPAMFPEDAESWNVQLFR
SIDGGAAFGFPDTPEDAARAGLVSGKDQIIDRSIQDAYIAAIRRARSFIYIENQYFLGSS
YCWKPNDGVKPEDVGALHLIPKELSMKVVSKIEAGERFTVYVVVPMWPEGIPESGSVQAI
LDWQRRTMEMMYTDIAHAIQAKGIDADPKDYLTFFCLGNREAKSAGEYEPPEQAEPDTGY
FHAQQNRRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLAAAGR
PARGQVHGFRMALWYEHLGTVDEAFQRPESLDCVRKVNAMADRCWDLYAGDGPERDLPGH
LLTYPVGVAGDGTITQLPGVEFFPDTQARILGAKSDYLPPILTT
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggcgaagatcctgctccatgggacgatgcacgtcaccatcttcgaggcggaatcgctc
tccaaccctagcaggccaagctcccaagcgccccagttcctccgcaagctggtggagggg
atcgaggacacggtgggcgtgggcaaggggacgagcaaggtgtacgccaccatcggcctc
gacaaggcccgcgtcggccgcacccgcacgctcgccgacgacaccgccgcgccgcgctgg
tacgagtccttccacgtctactgcgcccacctcgccacccacgtcgccttcaccctcaag
gccaagaaccccatcggcgcctccctcctcggcgtcggctacctccccgtccgggacgtc
ctcgccggcgacgaggtcgaccgctggctccccctctgcgacgacaccgacgcgcgcacc
cccatcggcgacggcggcggcaaggtccacgtcaagctccagtacttcgacatctccaag
gatcggagctggggccgcggcgtccgcagcggcaagtaccccggcgtgccctacaccttc
ttctcgcagcggcaaggatgcaaggtgacgttgtaccaggacgcccatgtccccgacggg
ttcatcccccggatcccgctcgacggcggccggagctacgagccgcaccggtgctgggag
gacatcttcgacgccatcaatggcgcgaggcattttatctatatcactggttggtcggtg
tacacggagatcgcgctgatcagggacgccgaccggccgaagcccggcggcggcgtgacg
ctcggcgagctgctgaagaagaaggccggcgagggcgtgagggtgctgatgctggtgtgg
gacgaccggacgtcggtggggatgctcaagaaggacgggctcatggcgacgcacgacgag
gagacgatgaactacttccagggcacggaggtgaactgcgtgctgtgcccgcgcaacccg
gacgactccggcagcatcgtgcaggacctgcagatctccaccatgttcacgcaccaccag
aagatcgtcgtcgtcgaccacgacatgccgtcgtcgcgccacggcggcggcaatggcggc
gggcggcggagggtggtgagcttcgtcggcgggctggacctctgcgacgggaggtacgac
acgccgttccactcgctgttccggacgctggggacggcgcaccacgacgacttccaccag
ccgaacttcgcgacggcgacggtggccaagggcgggccgcgcgagccgtggcacgacatc
cactgccgcctcgagggccccgtggcgtgggacgtgctctacaacttcgagcagcggtgg
cgcaagcagggcggcaaggacctcctcgtccagctccgggacctcgccgagacggtcatc
ccgccgtcgccggcgatgttcccggaggacgccgagtcgtggaacgtgcagctgttccgc
tccatcgacggcggcgccgcgttcggcttcccggacacccccgaggacgccgcccgcgcc
ggcctcgtcagcggcaaggaccagatcatcgaccggagcatccaggacgcctacatcgcc
gccattaggagggcgcggagcttcatctacatcgagaaccagtacttcctcgggagctcc
tactgctggaagcccaacgacggcgtcaagccggaagatgtcggcgcgctccacctcatc
cccaaggagctctccatgaaggtggtgagcaagatcgaggccggcgagcgcttcaccgtc
tacgtcgtcgtgccgatgtggccggagggcatcccggagagcggctccgtccaggccatc
cttgactggcagcgccgcactatggagatgatgtacaccgacatcgcccacgccatccag
gccaagggcatcgacgccgaccccaaggactacctcaccttcttctgcctcggcaaccgc
gaggccaagtccgccggcgagtacgagccaccggagcaggccgagcccgacaccggctac
ttccacgcgcagcagaatcgccgcttcatgatctacgtccacaccaagatgatgatcgtg
gacgacgagtacatcatcgtcgggtcggcgaacatcaaccagaggtcgatggacggggcg
agggactcggagatcgccatgggagcgtaccagccgcaccacctggcggcggcggggcgg
ccggcgagggggcaggtgcacgggttcaggatggcgctgtggtacgagcacctcggtacc
gtcgacgaggcgttccagcggccggagagcctcgactgcgtgcgcaaggtgaacgccatg
gcggacaggtgctgggacctctacgccggcgacgggccggagcgcgacctccccggccac
ctgctcacctaccccgtcggcgtcgccggcgacggcaccatcacgcagctccccggcgtg
gagttcttcccggacacccaggcgcggatccttggcgccaaatccgactacctcccgcca
attttgaccacttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341467
Entry
4341467           CDS       T01015                                 
Name
(RefSeq) phospholipase D alpha 2-like
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4341467
   00565 Ether lipid metabolism
    4341467
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4341467
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341467
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4341467
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4341467
 Endosome - Golgi transport
  Others
   Others
    4341467
SSDB
Motif
Pfam: PLD_C PLDc C2 PLDc_2
Other DBs
NCBI-GeneID: 4341467
NCBI-ProteinID: XP_015641366
UniProt: A0A0P0WYJ9 Q69X22
LinkDB
Position
6:complement(23908931..23913874)
AA seq 832 aa
MAEQQLMHGTLDATIFEATNLTNPTRLTGSAPEGIRKWWEGVEKTTGVGQGGTRLYATVD
LGKARLGRTRVIDDEPVNPRWDERFHLYCAHFADNVVFSVKVSLPIDAALIGRAYLPVGD
LLSGEVVERKLDILDEHKNKLPHGPTIHVRLQFKDVAVDGDGKWWGAGVGNAGYAGVPCT
YFKQHTGCGVTLYQDAHVPDTFAPTIPLAGGAHYQQGRCWEDVFDAISNAKHLIYITGWS
VFTDITLIRDPSRQRPGGDATIGELLKRKASEGVRVLMLVWNDVTSLQILQSLGIKWGFS
QTHDAETFQYFEDTDVHCVVCARHPDAGGSIVMGVKVPFASTHHQKTVIVDHDMPAGAGS
GLRSIVSFVGGLDLCDGRYDTQSHSLFRTLDAAHHKDFHQPSIDDAELAKGGPREPWHDI
HSRLEGPVAWDVLYNFEQRWRKQSGHGDLLVNLTALEHLIAPQSAMKLPVIGNDDHEAWN
VQVFRSIDGGACDGFPSSPDAAARLDLVSGKNNVIERSIQDAYIHAIRRARDFIYIENQY
FIGSSYGWRPDDGVRPEDVEAVNLIPRELSLKIMSKIAAGERFTVYVVVPMWPEGHPDSQ
AMQAILDWQRRTMEMMYADIAGALKAKRMDADPRDYLTFFCLGNREVKRSGEYVPGHHPR
DGTPYAKAQKTRRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHL
NIGGQLARGQIHGFRMSLWYEHLGGEPHDDFLHPGSLECVRRVNEMANKHWELYASEELH
EDLPGHLLTYPIAVAKDGTVAALPGAKFFPDTEAPVLGKKAINPLMTPDITS
NT seq 2499 nt   +upstreamnt  +downstreamnt
atggcggagcagcagctgatgcatggcaccctcgacgccaccatcttcgaggccaccaac
ctcaccaaccccacccgcctcaccggcagcgcccccgagggcatccgcaagtggtgggaa
ggggtggagaagacgaccggggttgggcagggcgggacgcggctgtacgcgacggtggat
ctcggcaaggcgcggctcggccggacgcgggtcatcgacgacgagccggtgaacccgcgg
tgggacgagcgcttccacctctactgcgcccacttcgccgacaacgtcgtcttctccgtc
aaggtctcgctgcccatcgacgccgcgctcatcggccgcgcctacctccccgtcggggac
ctcctgtccggcgaggtcgtcgagcgcaagctcgacatcctcgacgagcacaagaataag
ctcccccacgggccgaccatccacgtccgtctgcagttcaaggacgtcgccgtcgacggc
gacgggaagtggtggggcgccggcgtcggcaacgccgggtacgccggcgtgccgtgcacc
tacttcaagcagcacaccgggtgcggggtcaccctgtaccaggacgcgcacgtgccggac
acgttcgcgccgacgatcccgctcgccggcggcgcgcactaccagcaggggcggtgctgg
gaggacgtgttcgacgccatcagcaacgccaagcacctcatatacatcaccggctggtcg
gtgttcaccgacatcacgctcatccgcgacccgtcccggcagcgccccggcggcgacgcc
accatcggcgagctcctcaagcgcaaggccagcgagggcgtccgcgtgctcatgctggtc
tggaacgacgtcacgtcgctgcagatcctccagtcgctcggcatcaagtggggcttcagc
cagacgcacgacgccgagacgttccagtacttcgaggacaccgacgtccactgcgtcgtc
tgcgcgcgccaccccgacgccggcggcagcatcgtcatgggcgtcaaggtgcccttcgct
tccacccaccaccagaagaccgtcatcgtcgaccacgacatgccggccggcgccggctcc
ggcctccgcagcatcgtcagcttcgtcggcggcctcgacctctgcgacggccgctacgac
acgcagtcccactccctcttccggacgctcgacgccgcgcaccacaaggacttccaccag
ccgagcatcgacgacgccgagctcgccaagggcgggccgagggagccatggcacgacatc
cactccaggctcgagggccccgtcgcctgggacgtcctctacaacttcgagcagcggtgg
cggaagcagagcggccacggcgacctcctcgtcaacctcaccgccctcgagcacctcatt
gcgccgcagtccgcgatgaagctccccgtcatcggcaacgacgaccacgaggcgtggaac
gtgcaggtcttccgctccatcgacggcggcgcgtgcgacggcttcccgagcagcccggat
gcggcggcgcggctcgacctcgtgagcgggaagaacaacgtgatcgagcggagcatccag
gacgcgtacatccacgccatccgccgcgccagggacttcatctacatcgagaaccagtac
ttcatcgggagctcctacgggtggaggcccgacgacggcgtcaggccggaggacgtcgag
gcggtgaacctgatcccgagggagctctccctcaagatcatgagcaagatcgccgccggc
gagcggttcaccgtctacgtcgtggtgccgatgtggccggagggccaccctgacagccag
gccatgcaggccatcctcgattggcagaggaggacgatggagatgatgtacgccgacatc
gccggcgcgctcaaggcgaagaggatggacgccgacccgagggattacctcaccttcttc
tgcttgggaaacagagaggtgaagaggagtggtgagtatgtgcccggacatcacccaaga
gatggcacgccatatgccaaggcacaaaagacgcgccggttcatgatctatgtccactcc
aagatgatgatagtcgatgacgagtacatcatcgtgggatcggccaacatcaaccagagg
tcgatggacggcggccgagactcggagatcgccatgggagcattccagccacaccacctg
aacatcggtggccagcttgcaagaggtcaaatccatggcttccggatgtcactatggtat
gagcacctaggaggcgaaccgcacgacgacttcctgcacccggggagcctggagtgtgtc
cggagagtgaacgagatggctaacaagcactgggagctctacgccagcgaggagctccat
gaagacctcccggggcatctgctaacctacccgatcgccgtggctaaggacggcacggtg
gcggcgctcccgggggcgaagttcttcccggacaccgaggcgccggtgctggggaagaag
gcgatcaatccgttgatgacccccgatatcacctcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341468
Entry
4341468           CDS       T01015                                 
Name
(RefSeq) phospholipase D alpha 2-like
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4341468
   00565 Ether lipid metabolism
    4341468
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4341468
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341468
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4341468
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4341468
 Endosome - Golgi transport
  Others
   Others
    4341468
SSDB
Motif
Pfam: PLD_C PLDc C2 PLDc_2
Other DBs
NCBI-GeneID: 4341468
NCBI-ProteinID: XP_015641396
UniProt: A3BDD5 Q69X21
LinkDB
Position
6:23921924..23924921
AA seq 842 aa
MAHLLMHGTLDATIFEATNLTNPTRLTGNAPEGFRKWWEGLENGLEKTTGLGPGGTRLYA
TVDLGRARLGRTRVIDDEPVSPRWDERFHFYCAHFAENVVFSVKVALSVDAKLIGRAYLP
VRDLLSGEAVERKLDILGDDKKKLPHGPTIHVRLQFKDVAADGGGKWWGGGVGDAAYPGV
PCTYFKQHAGCRVTLYQDAHAPDTFAPRIPLAGGAHYQQGRCWEDVFDAISNAKHLIYIT
GWSVFTDITLIRDPSRQRPGGDATIGELLKRKASEGVRVLMLVWNDVSSIQALHAIGIKL
SVAQTHDEDTLAYFEDSDVHCVLCPRQADAAAGSSFIMGTKVSLLATHHQKTVIVDHDMP
AGTGGGGSDIRCIVSFVGGLDLCDGRYDTQSHSLFRTLDAAHHKDFHQPSIDDAELAKGG
PREPWHDIHSKLEGPIAWDVLYNFEQRWRKQSGHADLLVNLTALEHLITPPSPVKLPGTN
NDDHHDDAWNVQLFRSIDGGACDGFPSSPEAAARLDLVSGKNNVIERSIQDAYIHAIRRA
RDFIYIENQYFIGSSYGWRPGGGVRPEDVEAVNLIPRELSLKIVSKIAAGERFAVYVVVP
MWPEGHPGNEAMQAILDWQRRTMEMMYYDIAVALKANHSDADPRDYLTFFCLGNREAKSH
GEYVPAHRPDQDTDYAKAQNARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEI
AMGAFQPHHLNVNGQAARGQIHGFRMSLWYEHLGMLHDDFVHPGSLECVRRVNAMADRHW
QLYAGEELHGDLPGHLLTYPVAVEKDGGAVTALPGAEFFPDTEAKVIGTLASSAYMIPYL
TS
NT seq 2529 nt   +upstreamnt  +downstreamnt
atggctcacctgctgatgcacggcacgctcgacgccaccatcttcgaggccaccaacctc
accaaccccacccgcctcaccggcaacgcccccgagggcttccgcaagtggtgggaaggg
ctggagaacgggttggagaagacgaccgggcttggccccggcgggacgaggctgtacgcg
acggtggacctcggcagggcgcggctcggccggacgcgggtgatcgacgacgagccggtg
agcccgcggtgggacgagcgcttccacttctactgcgcccacttcgccgagaacgtcgtc
ttctccgtcaaggtcgcgctgtccgtcgatgccaagctcatcggccgcgcctacctcccc
gtcagggacctcctgtccggcgaggccgtcgagcgcaagctcgacatcctcggcgacgac
aagaagaagctcccccacggtccgaccatccacgtccggctgcagttcaaggacgtggcc
gccgacggcggcgggaagtggtggggcggcggcgtcggcgacgcggcgtaccccggcgtg
ccgtgcacctacttcaagcagcacgccgggtgcagggtcaccctgtaccaggacgcgcac
gcgccggacacgttcgcgccgaggatcccgctcgccggcggcgcgcactaccagcagggg
cggtgctgggaggacgtgttcgacgccatcagcaacgccaagcacctcatatacatcacc
ggctggtcggtgttcaccgacatcacgctcatccgcgacccgtcccggcagcgccccggc
ggcgacgccaccatcggcgagctcctcaagcgcaaggccagcgagggcgtccgcgtgctc
atgctggtctggaacgacgtctcctccatccaggcgctccacgccatcggcatcaagctc
agcgtcgcgcagacgcacgacgaggacacgctcgcctacttcgaggactccgacgtgcac
tgcgtcctctgcccgcggcaagccgacgccgccgccggcagcagcttcatcatgggcacg
aaggtctcactcttggccacccaccaccagaagaccgtcatcgtcgaccacgacatgccg
gccggcaccggcggcggcggctccgacatccgctgcatcgtcagcttcgtcggcggcctc
gacctctgcgacggccgctacgacacgcagtcccactccctcttccggacgctcgacgcc
gcgcaccacaaggacttccaccagccgagcatcgacgacgccgagctcgccaagggcggg
ccgagggagccatggcacgacatccactccaagctcgagggccccatcgcctgggacgtc
ctctacaacttcgagcagcggtggcggaagcagagcggccacgccgacctcctcgtcaac
ctcaccgccctcgagcacctcatcacgccgccgtccccggtgaagctccccggcaccaac
aacgacgaccaccacgacgacgcatggaacgtgcagctcttccgctccatcgacggcggc
gcgtgcgacggcttcccgagcagcccggaggcggcggcgcgcctcgacctcgtgagcggg
aagaacaacgtgatcgagcggagcatccaggacgcgtacatccacgccatccgccgcgcc
agggacttcatctacatcgagaaccagtacttcatcgggagctcctacgggtggaggccc
ggcggcggcgtcaggccggaggacgtcgaggcggtgaacctgatcccgagggagctctcc
ctcaagatcgtgagcaagatcgccgccggcgagcggttcgccgtctacgtcgtggtgccg
atgtggcccgagggccaccctggcaacgaggccatgcaggccatcctcgactggcagagg
aggacgatggagatgatgtactacgacatcgccgtcgcgctcaaggccaatcacagcgac
gccgacccgagggattacctcaccttcttctgcttggggaacagggaggccaagagccat
ggcgagtacgtgcctgcacatcgcccggatcaagacacagactacgccaaggcgcagaac
gcgcgccgcttcatgatctatgtccactccaagatgatgatagttgatgatgagtacatc
atcgtcgggtcggccaacatcaaccagcggtcgatggacggcgggcgggactcggagatc
gccatgggagcgttccagccacaccacctgaacgtcaatgggcaggctgcgagaggccag
atccatggcttccggatgtcgctgtggtacgagcacctggggatgctgcacgacgacttc
gtgcacccggggagcctggagtgtgtccggagagtgaacgcgatggccgacaggcactgg
cagctgtacgccggcgaggagctccacggcgacctccccggacacctgctcacctacccg
gtcgccgtcgagaaggacggcggcgccgtgacggcgctcccgggcgccgagttcttcccg
gacacggaggcgaaggtgatcgggacattggcgtcgtcggcgtacatgatcccctacctc
acgtcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341469
Entry
4341469           CDS       T01015                                 
Name
(RefSeq) phospholipase D alpha 2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4341469
   00565 Ether lipid metabolism
    4341469
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4341469
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341469
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4341469
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4341469
 Endosome - Golgi transport
  Others
   Others
    4341469
SSDB
Motif
Pfam: PLD_C PLDc C2 PLDc_2 DUF4474
Other DBs
NCBI-GeneID: 4341469
NCBI-ProteinID: XP_015643893
UniProt: P93844
LinkDB
Position
6:23928693..23932058
AA seq 817 aa
MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL
GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVREL
LSGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVAGDRHGWGRGVSGARYPGVPYTFFS
QRPGCRVTLYQDAHVPDAFAPRIPLAGGGYYRQGRCWEDVFDAISNAKHLIYLTGWSVYT
EITLIRDGTRQRPGGDATLGELLKRKASEGVRVLLLVWDDRTSVESLGMKWGFMSTHDAE
TADYFRGTDVRCVLCPRNPDAGRSAIMGAQIAYMITHHQKTVIVDHDMPVPRGGGSRRIV
SFVGGLDLCDGRYDTQFHSLFRTLDTAHHSDFHQPNLDGAAVTKGGPREPWHDIHSKIEG
PAAWDVLYNFEQRWRKQGGDKDLLLDLKAMADLIIPPSPVMFPDDGEAWSVQLFRSIDGG
ACFGFPSTPEAAARSGLVSGKNNTIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWKA
DGIRPEDIEALHLIPREISLKIVNKIEAGERFAVYVVLPMWPEGPPASGSVQAILDWQRR
TMEMMYYDIAVALEAKRINADPRDYLTFFCLGNREVKLNGEYEPAGRPLDGTDYAKAQKA
RRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPCHLNTKGLVARGQI
HGFRMSLWYEHLGMLHDNFLNPESLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPV
RVTKEGTVTELPGAKFFPDTQAPVIGTKGNLPPFLTT
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggctcacctgctgctgcacggcacgctcgaggccaccatcctcgaggccgaccacctc
tccaaccccacccgcgccaccggcgccgcccccgggatcttccgcaagttcgtggaaggg
ttcgaggactcgctggggctcgggaagggggcgacgcggctgtacgcgacgatcgacctc
ggccgggcgcgggtggggcggacgcgggtcgtcgacgacgagccggtgaacccgcggtgg
tacgaggtgttccacatctactgcgcccacttcgccgccgacgtggtgttctccgtcaag
gcggcgcagcccatcggcgccacgctcatcggccgcgcctacctccccgtcagggagctc
ctgtccggcgaggccatcgagcgccgcctcgacatcctcgacgccggcaggaggaggatc
tcgcacgggccgacgatacacgtgcggctgcagttccgcgacgtcgccggcgaccgccat
gggtggggcaggggcgtctccggcgcgcggtaccccggcgtgccgtacaccttcttctcg
cagcgccccgggtgcagggtcaccctgtaccaggacgcgcacgtgcccgacgcgttcgcg
cccaggatcccgctcgccggcggcgggtactaccggcaggggcggtgctgggaggacgtg
ttcgacgccatcagcaacgccaagcacctcatatacctcaccggctggtccgtgtacacc
gagatcacgctcatccgtgacggcacccggcagcgccccggcggcgacgccaccctcggc
gagctcctcaagcgcaaggccagcgagggcgtgcgcgtgctgttgctggtctgggacgac
cgcacctccgtcgagtcgctcggcatgaagtgggggttcatgtcgacgcacgacgccgag
acggcggactacttccgcggcaccgacgtgcgctgcgtcctctgcccgcggaaccccgac
gccggccggagcgccatcatgggcgcgcagatcgcctacatgatcacccaccaccagaag
accgtcatcgtcgaccacgacatgccagtgccgcgtggcggtggcagccgccgcatcgtc
agcttcgtcggcggcctcgacctctgcgacggccgctacgacacgcagttccactccctc
ttccggacgctcgacacggcgcaccacagcgacttccaccagcccaacctcgacggcgcg
gccgtcaccaagggcgggccgagggagccatggcacgacatccactccaagatcgaaggc
cccgcggcttgggatgtgctctacaacttcgagcagcggtggaggaagcaaggcggtgac
aaggacctcctcctagacctcaaagccatggccgacctcattattccgccgtctccggtg
atgttccccgatgacggtgaggcctggagtgttcagttgttccggtccatcgatggcggc
gcctgctttggcttccctagcactccagaggctgctgcaagatcaggccttgtcagtggc
aagaacaacaccattgacaggagcatccaagatgcatacatccacgcaattcgccgcgcc
aagaacttcatctacatcgagaatcagtacttccttggcagctcatttgcatggaaagcc
gatggcatcagaccagaagacattgaggcgttgcatctgattcccagagagatttctctg
aagattgtgaacaagattgaagctggtgagcgttttgcagtctatgttgtgctgccaatg
tggcctgaaggacctcctgctagtggatcagtgcaggcaatactggattggcagaggagg
acaatggagatgatgtactatgatattgccgttgcacttgaggcgaagaggatcaatgct
gacccgagggattaccttaccttcttctgcttagggaacagggaagtaaagttgaatggt
gagtatgaacctgcaggtcgccctttggatggcacagactatgctaaggcacagaaggca
cgccggttcatgatctatgttcactccaagatgatgatagttgacgacgagtacatcatt
gttggatctgccaacatcaaccagaggtccatggatgggggcagagactccgagatcgcc
atgggtgcattccagccatgccacctgaacaccaagggcctggttgcaagaggacaaatc
cacggtttccggatgtcgttgtggtatgagcaccttggcatgctgcatgacaacttcctg
aacccagagagcctggagtgtgttcagagggtgaacaagatggctgacaagtactgggac
ctctacgcgagcgatgagcttaacgatgaccttcctgggcacctgctgacctacccggta
cgtgttacgaaggaaggcacggtgacagagctcccaggagcgaaattcttccctgacact
caggctccagtgatcggcacgaaggggaacctgcctccctttctcaccacatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341683
Entry
4341683           CDS       T01015                                 
Name
(RefSeq) phospholipase D Z
  KO
K16860  phospholipase D3/4 [EC:3.1.4.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4341683
   00565 Ether lipid metabolism
    4341683
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341683
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     4341683
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4341683
SSDB
Motif
Pfam: PLDc_2 PLDc_3 PLDc Regulator_TrmB
Other DBs
NCBI-GeneID: 4341683
NCBI-ProteinID: XP_015641279
UniProt: Q0DAI9
LinkDB
Position
6:complement(26575125..26579922)
AA seq 512 aa
MRSSARGRGRLLLLLLLAAGAPAAPAAAEVATCKAWLVQSIPTDMPHLRRVPGVLSTADV
LQWLSGNATKSLDVLAQYWQFLAQPKNPKSGDYGYSESEMVRFGADKGQRVYKALEKAAD
RKIKIRIVQHSGFAPDFDKESADLAAGRPNVQNVTLLFGDWWGSGVVHAKVWISDKKDVY
IGSANNDWKSLSQVKELGIYFADCPQIAKTVEIYFQNLWKLSTLNSTAYTKVAWDKQWQA
FRKVPCWSHFLKPEERCRSPLPPSVDVPYVDGYPSLANPKMLDFSFETPGYKSSTKEHHL
SYLSYAPPELSFDKFQADEQGWLDTIKSVKFGGVVRISTMDWLGQSQYATQTVFWPSLSS
AISEVIFSKNATVRILVAYWTHFIPNTEKYLKSLLYSNILCTSSSYNHCMGKVEIKYYVV
PGYNKTGPALAQGAATGNRYPDFTRVNHGKYAVSDVRANIGTSNLIWDYFYTTAGVSFGT
YSPAIVSQLQDIFDADWFSPYTVPVKPLEASA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgcgttcctccgcccgcggccgcggccgcctcctgctgctcctcctcctcgccgccggt
gcgccggcggcgccggcggcggcggaggtggccacctgcaaggcgtggctggtgcagtcc
atccccaccgacatgccccacctgcggcgcgtccccggtgtcctctccactgcggatgtg
ctgcaatggctatctgggaatgctacaaaaagcctggatgtccttgctcaatactggcag
ttcttagctcaacctaagaaccctaaatcaggcgattatgggtactctgagagtgaaatg
gtaaggttcggagctgacaaggggcaacgggtttataaggcactggagaaagctgcagat
cgtaagatcaaaatcaggattgtgcaacactctggatttgcgcctgattttgacaaagag
agtgctgatctcgctgcaggaagaccaaatgtacaaaatgtaaccttactttttggtgat
tggtggggctctggtgttgtgcatgcaaaagtgtggatatctgacaaaaaggatgtgtat
attggatctgcaaacaacgattggaaatcccttagtcaggtgaaagagcttgggatttat
tttgctgattgtccacagatagcaaaaactgtggaaatatactttcaaaatctttggaaa
ctttcaactctcaactcaactgcttacaccaaagttgcctgggacaagcaatggcaagct
tttagaaaagtgccatgctggtcacattttctaaaaccagaagaaagatgcaggtcacct
cttccaccctctgttgatgtcccatatgtggatggctatccgtcacttgccaatcctaaa
atgcttgatttttcatttgaaacccctgggtataagagctctactaaggaacaccacttg
agctatctttcatatgctcctcctgagctttcatttgacaagttccaggcagatgagcag
ggttggcttgacaccatcaagtctgtcaaattcgggggagtggtgcggataagtactatg
gactggctgggacagtcgcaatatgcaactcaaacagtgttctggccatccttgtcatca
gcaatatcagaggtaatattctcaaagaatgcaactgtaaggatcctcgtagcctactgg
acgcacttcatcccgaacaccgaaaagtacttgaagagccttctatactcaaacatcctc
tgcacatcttccagctacaaccactgcatgggcaaggttgagatcaaatactatgtggtt
cctgggtacaacaagaccggacctgcattggcgcaaggcgctgcgacggggaatcgctac
cctgatttcacccgggtgaaccatggcaagtacgccgtcagcgatgtgagggcgaacatc
ggcaccagcaacctcatctgggattacttctacaccacagccggtgtcagcttcggaaca
tacagccccgccattgtttcgcagctgcaggatatctttgatgcagattggttttctcca
tacactgtacctgtaaaaccactggaagcatctgcataa

DBGET integrated database retrieval system