KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277526
Entry
107277526         CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 6A-like
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    107277526
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    107277526
   03400 DNA repair and recombination proteins [BR:osa03400]
    107277526
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     107277526
  RNA polymerase III system
   RNA polymerase III
     107277526
  RNA polymerase I system
   RNA polymerase I
     107277526
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      107277526
SSDB
Motif
Pfam: RNA_pol_Rpb6 Homeodomain Trypan_PARP Merozoite_SPAM
Other DBs
NCBI-GeneID: 107277526
NCBI-ProteinID: XP_015648324
LinkDB
Position
8:20468456..20470296
AA seq 148 aa
MAEDDYNDMDMGYEDEPPEPEIEEGAEEEPENNNEDAVDDVVGAEDDREQEKTARPWKTS
KYMTKYERARILSTRALQISMNAPVMVELEGGTYPLEVEALERVYTDCPKPTSARRQQLL
FLGTQVTLKVLLHCHVCLPPTLCLIPQL
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcggaggacgactacaacgacatggatatggggtacgaggatgagcccccagaacct
gagattgaggaaggagctgaggaagagcctgagaataacaatgaggatgctgtggatgac
gtggttggggctgaagatgacagggagcaagaaaagacggctcgcccatggaaaacatca
aagtatatgacaaaatacgagcgtgcacgcatccttagtacacgtgccttgcagataagc
atgaatgctcctgttatggtcgagcttgaaggggggacttatccacttgaggtggaggcg
cttgagcgggtgtataccgattgccccaagccaacctccgcgcgcaggcaacaactgctg
tttttaggtacccaggtaaccctcaaggtactcctgcactgtcacgtctgtctccccccg
acactctgcctgatcccccaactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333343
Entry
4333343           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 6A
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4333343
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4333343
   03400 DNA repair and recombination proteins [BR:osa03400]
    4333343
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4333343
  RNA polymerase III system
   RNA polymerase III
     4333343
  RNA polymerase I system
   RNA polymerase I
     4333343
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4333343
SSDB
Motif
Pfam: RNA_pol_Rpb6 Merozoite_SPAM
Other DBs
NCBI-GeneID: 4333343
NCBI-ProteinID: XP_015631727
UniProt: Q6F2V1 A3AJZ4
LinkDB
Position
3:complement(21637301..21641252)
AA seq 142 aa
MADDDYNDMDMGYEDEPPEPEIEEGAEEEPENNEDGPDEVVGAEAEDKEQEKTQRPRKTS
KYMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRARKIPFTIRRYLPDGS
YEDWGVDELIVEDSWKRQVGGG
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcggacgacgactacaacgacatggacatggggtatgaggatgagccaccagaacct
gagattgaggaaggggctgaagaggaacctgagaataacgaggatggccctgatgaggtt
gtaggggcagaggctgaagataaggaacaagaaaaaactcagcgcccacgcaaaacgtca
aagtatatgacaaagtatgagcgtgcccgcatcctgggtacacgtgcattacagataagc
atgaatgctccagttatggttgagcttgagggagaaactgatcctcttgagattgccatg
aaagagctgagagcacgcaagatcccattcacaattaggcggtacttacctgacggaagc
tatgaggactggggcgttgacgagcttattgtggaggactcctggaaacgccaggttgga
ggcggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343168
Entry
4343168           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 6A
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4343168
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4343168
   03400 DNA repair and recombination proteins [BR:osa03400]
    4343168
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4343168
  RNA polymerase III system
   RNA polymerase III
     4343168
  RNA polymerase I system
   RNA polymerase I
     4343168
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4343168
SSDB
Motif
Pfam: RNA_pol_Rpb6 Merozoite_SPAM
Other DBs
NCBI-GeneID: 4343168
NCBI-ProteinID: XP_015644995
UniProt: Q0D6M7 Q8LI69
LinkDB
Position
7:complement(16289953..16293457)
AA seq 142 aa
MAEDDYNDMDMGYEDEPPEPEIEEGAEEEPENNNEDAVDDVVGAEDDKEQEKTARPRKTS
KYMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRARKIPFTIRRYLPDGS
YEDWGVDELIVEDSWKRQVGGG
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcggaggacgactacaacgacatggacatggggtacgaggatgagcccccagaacct
gagattgaggaaggagctgaggaagagcctgagaataacaatgaggatgctgtggatgat
gtggttggggctgaagatgacaaggagcaggaaaagacggctcgtccacggaaaacatca
aagtatatgacaaaatacgagcgtgcacgcattcttggtacacgtgccttgcagataagc
atgaatgctcctgttatggtcgagcttgaaggggagactgatccacttgagattgccatg
aaagaattgagagcacgcaagatccctttcacaatcaggcggtatttacctgatggaagc
tatgaggactggggagttgatgagctcattgtagaggactcctggaaacggcaagttggt
gggggctaa

DBGET integrated database retrieval system