KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277614
Entry
107277614         CDS       T01015                                 
Name
(RefSeq) ubiquitin-like
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107277614
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107277614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107277614
   04121 Ubiquitin system [BR:osa04121]
    107277614
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107277614
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    107277614
  Archaea
    107277614
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   107277614
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107277614
  Exosomal proteins of colorectal cancer cells
   107277614
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ribosomal_S27 Ubiquitin_2
Other DBs
NCBI-GeneID: 107277614
NCBI-ProteinID: XP_015614163
UniProt: A0A8J8YEW6 Q9FWV0
LinkDB
Position
10:complement(18666276..18667110)
AA seq 147 aa
MSTVMTQIFVKGLTGKTTALRMEPSDTVESVKVKLVDKEGLPPDQQPLIFQGHQLDDGHT
LIYYGIQEESTLHLLGRICGGGGGNKKRKKKAYATPKKGKHEHRKEELAVLRHYRVDDVM
GKVERLRLMCPNPECKDVGALMAKHHD
NT seq 444 nt   +upstreamnt  +downstreamnt
atgtcgacggtgatgacgcagatatttgtgaaagggctgacagggaagacgacggctctg
aggatggagccgtcggatacggtggagagcgtgaaggtgaagctcgtggacaaggagggg
cttccgccagaccagcagccgctcatcttccaggggcatcagctggacgacggccacacg
ctaatctactatggtattcaggaggagtcgacgctgcacctcctcggtcgcatctgtggt
ggcggcggcggcaacaagaagcgaaagaagaaggcgtacgcgacacctaagaagggaaag
catgagcaccgcaaggaagagcttgcggtgctccgtcactatcgtgtcgatgacgtgatg
gggaaggtggagaggctacgactgatgtgtcctaacccagagtgcaaagacgttggcgca
cttatggcgaagcaccacgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326977
Entry
4326977           CDS       T01015                                 
Name
(RefSeq) ubiquitin-40S ribosomal protein S27a-1
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326977
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4326977
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326977
   04121 Ubiquitin system [BR:osa04121]
    4326977
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326977
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4326977
  Archaea
    4326977
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4326977
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4326977
  Exosomal proteins of colorectal cancer cells
   4326977
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Dsc3_N TBK1_ULD Ubiquitin_5 DUF2604 Ogr_Delta
Other DBs
NCBI-GeneID: 4326977
NCBI-ProteinID: XP_015621791
UniProt: Q9ARZ9
LinkDB
Position
1:complement(12645588..12646421)
AA seq 155 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRK
ECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQQA
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacggggaagacgatcacgctggaggtggagtcctcg
gacaccatcgacaacgtgaaggcgaagatccaggacaaggaggggatcccgcccgaccag
cagcggctcatcttcgccggcaagcagctggaggacgggcgcaccctcgccgactacaac
atccagaaggagtcgaccctccacctggtgctccgcctccgcggcggcgccaagaagcgc
aagaagaagacgtacaccaagcccaagaagcagaagcacaagcacaagaaggtgaagctc
gccgtgctccagttctacaaggtggacgacgccaccggcaaggtcacccgcctccgcaag
gagtgccccaacgccgagtgcggcgccggcaccttcatggccaaccacttcgaccgccac
tactgcggtaagtgcggcctcacctacgtctacaaccagcaggcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337883
Entry
4337883           CDS       T01015                                 
Name
(RefSeq) ubiquitin-40S ribosomal protein S27a-2
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4337883
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4337883
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4337883
   04121 Ubiquitin system [BR:osa04121]
    4337883
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337883
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4337883
  Archaea
    4337883
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4337883
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4337883
  Exosomal proteins of colorectal cancer cells
   4337883
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Dsc3_N Ubiquitin_5 DUF2604
Other DBs
NCBI-GeneID: 4337883
NCBI-ProteinID: XP_015639337
UniProt: P51431
LinkDB
Position
5:3535342..3536114
AA seq 155 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRK
ECPNNDCGAGTFMANHFDRHYCGKCGLTYVYNQKA
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacggggaagaccatcacgctggaggtggagtcctcg
gacaccatcgacaacgtgaaggccaagatccaggacaaggaagggatccccccggaccag
cagcgcctcatcttcgccggcaagcagctcgaggatggccgcaccctcgccgactacaac
atccagaaggagtccaccctccacctcgtgctccgcctccgcggcggcgccaagaagcgc
aagaagaagacgtacaccaagcccaagaagatcaagcacaagcacaagaaggtgaagctc
gccgtgctccagttctacaaggtggacgacgccaccggcaaggtcaccaggctcaggaag
gagtgccccaacaacgactgcggcgcgggcaccttcatggccaaccacttcgatcgccac
tactgcggcaagtgcggcctcacctacgtctacaaccagaaggcctag

DBGET integrated database retrieval system