KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277796
Entry
107277796         CDS       T01015                                 
Name
(RefSeq) probable CCR4-associated factor 1 homolog 11
  KO
K12581  CCR4-NOT transcription complex subunit 7/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107277796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    107277796
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107277796
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     107277796
SSDB
Motif
Pfam: CAF1 FAD_binding_2
Other DBs
NCBI-GeneID: 107277796
NCBI-ProteinID: XP_015645869
LinkDB
Position
7:complement(3706807..3707743)
AA seq 343 aa
MTLIMPGAPDVGSYYGEQWAPLAMSSLSSLFSYSPPGTAKYAAALASPSQQVSTTMPELE
TEGELKTLPAPMTIETTAAAAAAARSPEIVKVRSVWAHNLDEEANLIESLFPSFRLAAVD
TEFPGTVHRPSAPAYTLTRKQKYALLKKNVDELHLVQLGLTLFDAGGRLPDLGTGGAARY
VWEFNFREFDLRRHAHAPESIALLRSKGVDFDRTRRGGVDAAAFGPRLRRWLRAGLGRAG
LVTFSGAYDLAYMLKMLYGRTLYDVGKMARHCPGDMRGGLERVAGKLGVRRAVGEAHQAG
SDSLLTSQMFMRMRERYFDDQDALTAVAGINFGYLNFTSCEYT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgacgctgatcatgccgggggcgccggacgtcggcagttactacggcgagcagtgggcg
ccgctggcgatgtcgtcgctgtcgtcgctgttctcctactcaccgccggggacggccaag
tacgcggcggcgctggcgtcgccgtcgcagcaggtgtccacgacgatgccggagctggag
acggagggggagctgaagaccctgccggcgccgatgacaatcgagacgacggcggcggcg
gcggcggcggctcggtcgccggagatcgtcaaggtgcggtcggtgtgggcgcacaacctc
gacgaggaggccaacctgatcgagtcgctgttcccgagcttccggctcgccgccgtcgac
accgagttccccggcacggtgcaccggccgtcggcgccggcgtacacgctgacgcgcaag
cagaagtacgcgctcctcaagaagaacgtcgacgagctccacctagtccagctcggcctg
acgctgttcgacgccggcggccggctgccggacctcggcaccggcggcgccgcgcgctac
gtgtgggagttcaacttccgggagttcgacctccggcgacacgcgcacgcgccggagtcg
atcgcgctgctgcgttccaagggcgtcgacttcgaccggacgcggcggggcggcgtcgac
gcggcggcgttcggcccgcggctgcgcaggtggctgcgcgccggcctcggccgcgccggg
ctcgtcacgttcagcggcgcctacgacctcgcctacatgctcaagatgctctacgggagg
acgctgtacgacgtgggcaagatggcgcggcactgccccggcgacatgcgcggcgggctg
gagcgcgtcgccgggaagctcggcgtgcggcgcgccgtcggcgaggcgcaccaggccggc
tctgacagcctgctgacgtcgcagatgttcatgcggatgagggaacgctacttcgacgac
caagacgcgctcacggccgtcgccggcattaattttggatatttaaactttacctcctgt
gaatatacttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331006
Entry
4331006           CDS       T01015                                 
Name
(RefSeq) probable CCR4-associated factor 1 homolog 7
  KO
K12581  CCR4-NOT transcription complex subunit 7/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331006
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331006
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4331006
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4331006
SSDB
Motif
Pfam: CAF1
Other DBs
NCBI-GeneID: 4331006
NCBI-ProteinID: XP_015625500
UniProt: B9F411 Q0DWT7
LinkDB
Position
2:33854157..33855652
AA seq 295 aa
MPMSDPTAAVIPKPGGIGVGGGGGDDEEPVEIREVWADNLEEEFALIRDVVDEFPFVAMD
TEFPGIVCRPVGAFRSPADYNYATLKANVDMLHLIQLGLTFSSPRGELPALGPGRRRCVW
QFNFREFDDARDIFASDSIELLRRSGIDFRRNSERGVDARRFAELLMSSGVVLNDSVYWV
TFHAGYDFGYLLKILTCSSLPDTQAGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAE
LLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAGVLYGLNAENVVSAH
NT seq 888 nt   +upstreamnt  +downstreamnt
atgccaatgtcggatcccacggcggcggtcatccccaagccggggggcatcggcgtcggc
ggcggaggcggcgacgacgaggagccggtggagatccgggaggtgtgggcggacaacctc
gaggaggagttcgcgctgatccgcgacgtcgtcgacgagttccccttcgtcgccatggac
acggagttccctggcatcgtgtgccgccccgtcggcgccttccgctccccggccgactac
aactacgccacgctcaaggccaacgtcgacatgctccacctcatccagctcggcctcacc
ttctccagcccgcgcggcgagctccccgcgctcggcccaggccgccgccgatgcgtatgg
cagtttaatttccgcgagttcgacgacgcccgcgacatcttcgcctctgactccattgag
ctcctgcgccgtagcggcatcgacttccgccgcaactccgagcgcggcgttgacgctcgc
cggttcgcggagctgctcatgtcctctggcgtcgtgcttaacgattctgtatattgggtc
accttccacgcgggctacgacttcgggtacctgcttaagatcctcacatgcagcagccta
ccggacacgcaagccggcttctttaagctcatgaagatatatttccccaccgtgtatgac
atcaagcacctcatgaagttctgcaatagcctgcacggtgggctgaacaagctcgccgag
ctccttgacgtggagcgcgtcggagagtcccaccaggccggttcagatagcttggtcact
tcatgcgcgttctggaagctcaaggattcgttcttcgctggctctaccgagaaatatgct
ggagtgctgtatgggctcaatgcggagaatgttgtcagtgcgcattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337457
Entry
4337457           CDS       T01015                                 
Name
(RefSeq) probable CCR4-associated factor 1 homolog 11
  KO
K12581  CCR4-NOT transcription complex subunit 7/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4337457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4337457
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4337457
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4337457
SSDB
Motif
Pfam: CAF1
Other DBs
NCBI-GeneID: 4337457
NCBI-ProteinID: XP_015635906
UniProt: Q7XPU5 A0A8J8XY44
LinkDB
Position
4:34980583..34981831
AA seq 329 aa
MPSEFVAARKKPPPELLFAAGRKKQQPPPPGMAFVPSEFAAAGVGRKRQPAPPVEIRRVW
AHNVEEEFRIIRNAIDHFPYVSMDTEFPGVIHRPTKHPALLTAGDRYDLLRRNVDALHLI
QVGITLAASPTAAPALAFEINLSDFDQRVHRHAAESVQLLAEHGVDLAAHRRHGVRASAL
APLLMSSGLVCSHGAVKWVTFHSAYDFAYLVKLLMGRKLPRSMAEFLNLVRVFFGDEVYD
VKHMMRHCGGELYGGLERVAAALQVKRAAGRCHQAASDSLLTWDVFRRMRELYFLKHGVE
AYQGVLFGLELDMDMPSNKTPSLPLVAAR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgccgtcagagttcgtcgccgccaggaagaagccgccgccggagttgttgttcgccgcc
ggtcggaagaagcagcagccgccgccgcctggcatggcgttcgtgccgtcggagttcgcc
gccgccggcgttggcaggaagaggcagcctgcgccgccggtggagatacgccgggtgtgg
gcgcacaacgtggaggaggaattccggatcatccgcaacgcgatcgatcacttcccgtac
gtgtccatggacacggagtttcccggcgtgatccaccgcccgaccaagcaccccgccctg
ctcaccgccggcgaccggtacgacctcctccgccgcaacgtggacgcgctccacctcatc
caggtgggcatcaccctcgccgcgtcccccaccgcggcgcccgcgctcgccttcgagatc
aacctctccgacttcgaccagcgcgtccaccgccacgccgccgagtccgtccagctgctg
gcggagcacggcgtggacctcgccgcgcaccgcaggcacggcgtcagggcgagcgcgctg
gcgccgctgctcatgtcgtcgggcctcgtctgctcccacggcgccgtcaagtgggtcacc
ttccactccgcctacgacttcgcctacctggtcaagctcctcatggggcggaagctgccg
aggtccatggccgagttcctgaacctggtgcgcgtcttcttcggcgacgaggtgtacgac
gtgaagcacatgatgcggcactgcggcggcgagctgtacggcgggctggagcgcgtggcg
gcggcgctgcaggtgaagcgcgcggcggggcggtgccaccaggccgcctccgacagcttg
ctcacctgggacgtcttccggcggatgcgggagctctacttcctcaagcatggcgtcgag
gcctaccaaggcgtgctcttcggcctggagctcgacatggacatgcccagcaacaaaaca
ccctcgctgccgctggtggcagcgagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345683
Entry
4345683           CDS       T01015                                 
Name
(RefSeq) probable CCR4-associated factor 1 homolog 7
  KO
K12581  CCR4-NOT transcription complex subunit 7/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4345683
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4345683
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4345683
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4345683
SSDB
Motif
Pfam: CAF1
Other DBs
NCBI-GeneID: 4345683
NCBI-ProteinID: XP_015651075
UniProt: A3BTI8 Q6Z9G7
LinkDB
Position
8:21418721..21420017
AA seq 288 aa
MAAAAAACVESPDEGVEIREVWAGNLEAEIAAIRDEVDRYPYVAMDTEFPGIVCRPVGNF
RTTDEFNYANLEANVNMLKLIQLGLTLSDEGGDLPRRGTGGRRCIWQFNFRGFDPRTDPS
NADSIQMLRTCGIDFDRFAAEGADPIRFAELLMSSGVVLNADVQWITFHSGYDFGYLLRL
LTGRNLPDNMPAFFDLIRIYFPVLYDIKHLMRFCSNLHGGLSRLGELLDVKRVGTCHQAG
SDSLLTLGCYNKIKEVYFKGSTEKHAGVLYGLVIEDGVNRPPPTQPNE
NT seq 867 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgcagcctgcgtagagagccccgacgagggcgtggagatccgggag
gtatgggcggggaacctggaggcggagatcgcggcgatccgcgacgaggtcgaccggtac
ccgtacgtcgccatggacacggagttcccgggcatcgtgtgccgccccgtcggcaacttc
cgcaccaccgacgagttcaactacgccaacctcgaggccaacgtcaacatgctcaagctc
atccagctcggcctcaccctctccgacgagggcggcgacctcccgcggcgggggacgggg
ggcaggcgctgcatctggcagttcaacttccgcgggttcgacccccggaccgacccgtcc
aacgccgactccatccagatgctccgcacctgcggcatcgacttcgatcggttcgccgct
gagggggccgacccgatccgcttcgccgagctgctcatgtcgtcgggcgtcgtgctcaac
gccgacgtgcagtggatcaccttccacagcgggtacgacttcggttacctgctcaggctg
ctcaccggccggaacctgccggacaacatgcccgccttctttgacctcatcagaatctac
ttcccggtgctctacgacatcaagcacctcatgaggttctgcagcaacctccacggcggc
ctgagcaggctcggtgagcttcttgatgtcaagcgtgtggggacctgccaccaggccggc
tctgactcgctgttgaccctcgggtgctacaacaagatcaaggaggtgtacttcaaagga
tcgaccgagaagcatgccggtgtgttgtatgggcttgttattgaggatggggtgaacaga
ccaccaccaactcagcccaatgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347066
Entry
4347066           CDS       T01015                                 
Name
(RefSeq) probable CCR4-associated factor 1 homolog 7
  KO
K12581  CCR4-NOT transcription complex subunit 7/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4347066
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4347066
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4347066
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4347066
SSDB
Motif
Pfam: CAF1
Other DBs
NCBI-GeneID: 4347066
NCBI-ProteinID: XP_015611819
UniProt: Q6EQ06 Q6EQZ6
LinkDB
Position
9:14929162..14930786
AA seq 280 aa
MATPAAEKPDGVEIREVWEDNLEAEFAVIREIVDDFPYVAMDTEFPGVVCRPLGTFKSNA
DFNYATLKANVDMLKLIQLGLTFSNEHGGLPSLGPEGRPCVWQFNFRGFDPRTDVAAADS
IDLLRRSGIDFTRHSADGADARRFAELLMSSGVVMNSEVRWVTFHSGYDFGYLLKLLTGT
YLPDTITGFFDLIRIYFPVVYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSL
LTALSFKKLKEAYFNGLTEKYAGVLYGLGTEGGETSSAAH
NT seq 843 nt   +upstreamnt  +downstreamnt
atggcgacgccggccgccgagaagcccgacggggtggagatccgcgaggtgtgggaggac
aacctcgaggccgagttcgcggtgattcgggagatcgttgacgacttcccgtacgtcgcg
atggacacggagttcccgggcgtcgtctgcaggccgctcgggacgttcaagtccaacgcc
gatttcaactacgcaacgctcaaagccaacgtcgacatgctgaagcttatccagcttggt
ttaaccttctcgaatgagcatggtgggctcccgtcgcttggccccgagggtcgaccttgt
gtttggcagttcaactttcgtggcttcgatccccggaccgacgtcgctgctgcagattcc
attgacttgctccggcgcagcggtattgacttcacccgtcactcggctgacggcgctgat
gctcgccgcttcgctgagcttctcatgtcgtcgggcgttgtgatgaactctgaggttcgc
tgggttacgttccatagcggatacgactttggctacttgctcaagttgctcaccggcaca
tacctgccagacacgataaccggattcttcgacctcatcaggatatatttccccgtcgtg
tatgacatcaagcacttgatgcggttctgcaacagcctccatggtgggctgaacaagctt
gccgagctgcttgatgttgagcgcgttggaatttgtcatcaggctggttccgactcgctg
ttgaccgcgctgtcattcaaaaagctcaaggaagcatacttcaatgggttaaccgagaag
tatgccggtgtgttgtatggtcttggcacagaaggtggggagacctcctctgctgctcac
taa

DBGET integrated database retrieval system