KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277843
Entry
107277843         CDS       T01015                                 
Name
(RefSeq) cytochrome P450 71A1-like
  KO
K20623  typhasterol/6-deoxotyphasterol 2alpha-hydroxylase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    107277843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    107277843
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP92 family
   107277843
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107277843
NCBI-ProteinID: XP_015611388
UniProt: Q69P72
LinkDB
Position
9:16392711..16396915
AA seq 518 aa
MEFLLWVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIH
SLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTW
SPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASGRVVALKDYLSAAS
LNVISRMVLGKKYLEREVVHEGEVVTTPERFRWMIDELFLLNGVLDIGDSIPWLGWLDLQ
GYIRRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDVLLNVASDPSLEVKFSRD
SVKAFTQDLIAGGTESSSATVDWAIAELLRKPEVFAKVTEELDRVVGRGRWVTEKDIPSL
PYIDAIMKETMRMHPVAPMLAPRLSREDTSVDGYDIPAGTRVLVGVWSIGRDPKLWDAPE
EFMPERFIGSKIDVKGQDFELLPFGSGRRMCPGYSLGLRVIQVSLANLLHGFAWRLPDGM
TKEQLSMEEIFGLSTPRKFPLEVVVEPKLPADLYVSAC
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggagtttctactatgggtatcctaccttaccatcacactcgccaccatcctcttattt
cttagaaccctgatcttgaggcacaaccgccgggtgtacaacctccctcctgggcctaag
ccatggccaatcatcggcaacctcaacctcatgggctcactcccacaccgctccatccac
agcctctccaagaagtacggtcccctgatgcacctcaggttcgggtccttccccgtcgtc
gttggctcgtcggtggagatggccaagttcttcctcaagacccacgacgtggtgttcgcc
gaccggcccaagaccgccgccggcaagcacaccacctacaactacagcgacatgacgtgg
tcgccctacggcgcgtactggcgccaggcgcgcaaggtgtgcctcgccgagctcttcagc
gccaagcggatcgagtcgtacgagcacatccgccgcgaggaggtgcgcgcgctgctccgc
gatctgcacgcggcgtccgggcgcgtggtggcgctcaaggactacctgtccgcggcgagc
ctgaacgtgatctcgcgcatggtgctcggcaagaagtacctggagcgcgaggtggtgcac
gagggagaagtggtgacgacgcccgagcggttcaggtggatgatcgatgagctcttcctg
cttaacggcgtgctcgacattggggattcgatcccgtggttgggctggctggacctgcag
gggtacattcggaggatgaagaagctgagcaagatgtttgatcagttcctggaatatgta
ttggacgagcatgagaaccggatgtgtcgcgagggggagagcttcgtggcgaaggacatg
gtggatgtgctgctcaatgtcgccagcgatccttcgctggaggtcaagttcagccgtgac
agcgtcaaggcattcacccaggacctcatcgctggcggcacggagagctcatcggccact
gtggattgggccatcgcggagcttctcaggaagccggaggtgttcgccaaggtcaccgag
gagctggaccgtgtcgtcggccgcggccgctgggtcacggagaaggacatcccgagcctc
ccctacatcgacgccatcatgaaggagacgatgcgaatgcacccggttgcgcccatgctt
gcgcctcgcctgtcccgcgaagacacgtccgtcgacggctatgacatccccgctggcacg
cgggtgctcgtcggcgtctggtccatcggccgcgaccccaagctgtgggacgcgccggag
gagttcatgccggagaggttcatcggcagcaagatcgacgtgaaggggcaggatttcgag
ctgctgccgttcgggtcgggccggcggatgtgccccggctacagccttgggctgagggtg
atccaggtgagcctcgccaacctgctgcacggcttcgcgtggaggctgcccgacggcatg
acgaaggagcagctgagcatggaggagatcttcggtttgtcgacgccgcgcaagttcccg
ctcgaggttgtcgtcgagcccaagctcccggctgacctctatgtgtctgcttgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345751
Entry
4345751           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 71A1
  KO
K20623  typhasterol/6-deoxotyphasterol 2alpha-hydroxylase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4345751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4345751
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP92 family
   4345751
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4345751
NCBI-ProteinID: XP_015649625
UniProt: A0A5S6R7H5
LinkDB
Position
8:complement(22369353..22370939)
AA seq 520 aa
MEPSALATLLSMALAAFLLLGLIKRKGSRRGYNLPPGPTPWPVIGNFNLIGALPHRSIHE
LSRKYGELMLLRFGSFPVVVGSSVAMARLVLKTHDAVFIDRPRTASRKHTTYGYADITWS
PYGAYWRQARRICVTELFSARRVASFEHIRADEVRALVRGLFAAASSGRSGAVHLNRDHL
STLSMNVITRMVLGKRFFGEGADAAEGPVSTLSEFKWMLDELLLLNGVLNVGDWIPWVDW
MDLQGYVRRMKKVGKMFDAFMEHVLDEHSERRRREGEAFVARDMVDVLMDLADDPSLEIK
LGRVGVKAFTQDLIAGGTESSSVTVEWALSELFKNPAIFATATDELDRVVGRCRWVTEKD
IPNLPYLDAIMKETMRMHPIVPLLIPRVARDDAAVAGYDIPKGARVLINVWTIGRDPELW
DAAEEFMPERFIGSRIDVKGQDFELLPFGSGRRMCPGYNLGLKVMQLSLANLLHGFAWRL
PEGMKEEELSMDEVFGLSTTRKYPLQVVVEPRLPVQLYSL
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggagccatcagcattggccaccttgctatccatggcgctcgccgccttcctgctactc
gggctgatcaaacgcaagggcagccgccgtggctacaacctgccgccgggtccgacgccg
tggcccgtcatcggcaacttcaacctcatcggcgcgctgccgcaccgctccatccatgag
ctctccaggaagtacggcgagctcatgctcctccgcttcggctccttccccgtcgtcgtc
ggctcgtcggtcgccatggccaggctcgtcctcaagacccacgacgcggtgttcatcgac
cgccccaggacggcgtccaggaagcacaccacctacggctacgccgacatcacgtggtcg
ccgtacggcgcgtactggcgccaggcgcggcggatctgcgtcaccgagctgttcagcgcc
cgccgcgtcgcgtcgttcgagcacatccgcgccgacgaggtgcgcgcgctggtgcgcggc
ctcttcgccgcggcgtcgtcgggacgcagcggcgccgtgcacctcaacagggatcacctg
tccacgctgagcatgaacgtgatcacgcggatggtgctcgggaagcggttcttcggcgag
ggcgcggacgcggcggaggggcccgtgtcgacgctgtcggagttcaagtggatgctggac
gagctcctcctgctcaacggcgtcctcaacgtcggcgactggatcccgtgggtggactgg
atggacctgcaggggtacgtgcggcggatgaagaaggtgggcaagatgttcgacgcgttc
atggagcacgtcctcgacgagcacagcgagcggcggcggcgcgagggcgaggcgttcgtg
gcgagggacatggtggacgtgctcatggacctcgccgacgacccctccctcgagatcaag
ctcggccgcgtcggcgtcaaggcgttcacgcaggacctcatcgccgggggcacggagagc
tcgtcggtgactgtggagtgggcgctctcggagctcttcaaaaaccccgccatcttcgcc
acggccaccgacgagctcgaccgcgtcgtcggccgctgccgctgggtcacggagaaggac
atcccgaacctcccctacctagacgccatcatgaaagagaccatgcggatgcaccccatc
gtgccgctcctcatcccgcgcgtcgcccgcgacgacgccgccgtcgcgggctacgacatc
cccaagggcgcgcgcgtgctcatcaacgtgtggaccatcggccgggacccggagctgtgg
gacgcggcggaggagtttatgccggagaggttcatcgggagcaggatcgacgtgaagggg
caggacttcgagctgctgccgttcgggtccgggcggcgcatgtgccccggctacaacctc
gggctcaaggtgatgcagctgagcttggccaacctgctgcacgggttcgcgtggaggttg
ccggaggggatgaaggaggaggagctgagcatggacgaggtgtttgggctgtcgaccacg
cgcaagtacccgctccaggtggtcgtcgagcctaggcttcccgttcaactctactcctta
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347175
Entry
4347175           CDS       T01015                                 
Name
(RefSeq) flavonoid 3'-monooxygenase
  KO
K20623  typhasterol/6-deoxotyphasterol 2alpha-hydroxylase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4347175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4347175
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP92 family
   4347175
SSDB
Motif
Pfam: p450 BtrH_N
Other DBs
NCBI-GeneID: 4347175
NCBI-ProteinID: XP_015611374
UniProt: Q69P77 A0A0P0XME0
LinkDB
Position
9:complement(16361323..16363295)
AA seq 525 aa
MEMELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSI
HELSKRYGPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDIL
WSPYGAYWRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLHGAAAPVLLRDYLSTAT
LGVISRMVLGKKYVGVEGASAGNGGGGEGTSPAATPEEFKMMMDELFLLSGVLNIGDFIP
WLDWLDLQGYIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGDRFAARDLVDVLLQLADDPN
LEVQLRRDNVKALTQDLIAGGTDTSAITVEWAISELLRKPEILAKATEELDRVVGRGRLV
TETDMTSLPYVEAIVKETMRVHPVAPLLAPHVAREDASVGGYDIPAGTRVLVNVWTIARD
PALWDSPEEFMPERFIGSKIDVKGQDFQLLPFGSGRRLCPGHSLGLKVIQLSLASLLHGF
EWRLPDGVSAGELSMEEVFGLSTPRKVPLEVVVKPKLPAHLYTGP
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggagatggagctaccatcatgggcctcagtactggtcattgtgctcgccgccgtcgtc
ttcctcctcgccaccattctccgccatggccgacgcgcgtataggctcccaccagggcct
aacccgtggccgatcatcggcaacctcaacctcattggcgcgctgccacaccgctccatc
cacgagctctccaagcgctacggcccgctgatgcagctccggttcgggtcattccccgtc
gtcgtcggctcgtcggcggagatggccaggttcttcctcaagtcccacgacattgtgttc
accgaccggccgaggaccgccgccggcaagcacaccacgtacaactacaccgacatcctc
tggtccccctacggcgcctactggcgccaggcgcgcaagatgtgcgtcaccgagctcttc
agcgcgaggcggctcgagtcgttcgagcacatccgcggcgaggaggtgcgcgcgctgctg
cgcgacctgcacggcgcggcggcgcccgtgctgctcagggactacctgtccacggcgacg
ctcggcgtgatatcgcgcatggtgctgggcaagaagtacgtgggggttgagggagcttct
gccggcaacggcggcggcggcgaggggacgagcccggcggcgacgccggaggagttcaag
atgatgatggacgagctgttcctgctgagcggcgtgctcaacatcggcgacttcatcccg
tggctagactggctcgacctgcaggggtacatcaggaggatgaagagagtaggcaagaaa
ctggatcggttcatggagcacgtcctggacgagcacgacaaggtgcggcggcagcagggt
gataggtttgcagcgagggacttggtcgacgtgctcttgcagctcgccgatgaccctaac
ctcgaggtccaactccggcgtgataatgtcaaggcacttactcaggacctgatcgccggc
ggcacggacacctccgccatcaccgtggagtgggccatttcggagctcctgaggaagccg
gagatcctcgccaaggcgaccgaggagctggaccgcgtcgtcggccgcggccgcttggtc
accgagacggacatgaccagcctcccctacgtggaggccatcgtgaaggagacgatgcgc
gtgcacccggtggcgcccctgctggcgccgcacgtagcccgcgaggacgcctccgtcggc
ggctacgacatccccgccggaacgcgggtgctcgtcaacgtgtggaccatcgcccgcgac
ccggcgctgtgggactcgccggaggagttcatgccggagaggttcatcggcagcaagatc
gacgtgaagggacaggacttccagctgctgccgttcgggtccggccgccggttgtgcccc
ggccacagcctcgggctgaaggtgatacagctgagcctcgccagcctgctgcacggcttc
gagtggaggctccccgacggcgtgtcggccggcgagctgagcatggaggaggtcttcggc
ctgtccacgccgaggaaggttccgctcgaggtcgtcgttaagcccaagctgccggcccac
ctctataccgggccctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347176
Entry
4347176           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 71A1
  KO
K20623  typhasterol/6-deoxotyphasterol 2alpha-hydroxylase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4347176
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4347176
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP92 family
   4347176
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4347176
NCBI-ProteinID: XP_015612425
UniProt: Q0J1G6 Q69P73
LinkDB
Position
9:16387706..16390391
AA seq 514 aa
MELMLPPWASFVGVVLATVLFLKAVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIH
NLSKKYGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITW
SPYGAYWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAGGVVVLKDYLSTVS
LNVITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYI
KRMKKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLEVKLKREGVK
AFTQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSLTYV
DAIVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPEEFM
PERFIGNKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGVTRE
QLSMEEIFGLSTPRKFPLEAVVEPKLPAHLYAAA
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggagctgatgctgccgccatgggcgtccttcgtcggcgtagtgctcgccaccgtgctg
ttcctgaaagcggtgctcggccgtagccgccgcgtgtacaacctcccgccggggccgaag
ccgtggccggtcatcggcaacctcaacctggtgggcacgctcccgcaccgctccatccac
aacctctccaagaagtacggtcccctgatgtacctcaggttcgggtcgttccccgtcgtc
gtcggctcgtcggtggagatggccaagttcttcctcaagacccacgacgtggtgttcacc
gaccggcccaagaccgccgccggcaagcacaccacctacaactacagcgacatcacgtgg
tcgccctacggcgcgtactggcgccaggcgcgcaagatgtgcctcaccgagctcttcagc
gccaagcggctggagtcgtacgagtacatccgtggcgaggaggtgcgcgcgctgctgcgc
gacctgcacggcgcggccggcggcgtcgtggtgctcaaggactacctgtcgacggtgagc
ctgaacgtgatcacgcgcatggtgctgggcaagaagtacctggacaaggatgcggggggg
tcggtgacgacgccggaggagttcaagtggatgctcgacgagctgttcctgctcaacggc
gtgctcaacatcggcgactccatcccgtggctcgactggctggacctgcaggggtacatc
aagaggatgaagaagctcggcaagatgttcgaccggttcctggaacacgtcgtggacgag
cacaacgagcgccgccgccgcgagggggagagcttcgtggccaaggacatggtggacgtg
ctgctgcagttcgctgacaatcccaaccttgaggtcaagctcaagagggaaggtgtcaag
gcattcactcaggacctcatcgctggcggcacagagagctcggcggtgaccgtggagtgg
gcgctgtcggagctcctgaagaagccggaggtgttcgccaaggccaccgaggagctggac
cgcgtcgtgggccgcggccgctgggtcacggagaaggacgtcccgagcctcacctacgtg
gacgccatcgtgaaggagaccatgcggctgcacccggtggcgcccatgctggtgccccgc
ctgtcccgcgaggacacgtccgtcgacggctacgacatccccgccggcacgcgggtgctc
gtcagcgtgtggaccatcggccgcgaccccaagctgtgggacgcgccggaggagttcatg
ccggagaggttcatcggcaacaagatcgacgtgaaggggcaggacttcgagctgctgccg
ttcgggtcgggccggcggatgtgccccggctacagccttgggctgaaggtgatccagctg
agcctcgccaatctgctgcacggcttcgcgtggaggctgcccgacggcgtgacgagggag
cagctgagcatggaggagatcttcggcttgtcgacgccgcgcaagttcccgcttgaggct
gtcgtcgagcccaagctgcccgctcacctctatgctgctgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271796
Entry
9271796           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 71A1
  KO
K20623  typhasterol/6-deoxotyphasterol 2alpha-hydroxylase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    9271796
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    9271796
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP92 family
   9271796
SSDB
Motif
Pfam: p450 RHH_1 Serine_rich
Other DBs
NCBI-GeneID: 9271796
NCBI-ProteinID: XP_015610895
UniProt: Q67UV1
LinkDB
Position
9:complement(16403658..16408144)
AA seq 522 aa
MEVALCASFVAILLTTMLFLKAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHE
LSRRYGPLVYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWS
PCDAYWRQARRVVLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLS
TASLNMITRMVMGKRYVQGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLE
WLDLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLEV
KLSRDSIKAFTQDLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEK
DILDLPYIEAIVKETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTL
WDASEEFMPERFLGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWR
LPKDMVKEDLSMEEIFGLSMPRKFPLEVAVEPKLSSHLYKGD
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggaggtagcactctgtgcatcctttgttgccattctgctaaccaccatgctcttccta
aaagccatctcgacgaggtgccgccgtcgaaagtataacctcccgccgggtcccaagcca
tggccgatcatcggcaacctaaacctcgtcggtgcgctcccacaccgttccatccacgag
ctctcaaggcgctacggcccactcgtatacctccggttcgggtccttccccgtcgtcgtc
ggctcgtccgtcgagatggccaggttcttcctcaagacgcgcgacgcggcgttcatcgac
cgccccaggacggccgccggcaagcacaccgcctacaactaccgcgacatcacgtggtca
ccctgcgacgcgtactggcgccaggcgcgcagggttgtcctcaccgagctcttcagcgcc
aggcggatcgagtcgtacgagcacatccgccgcgaggaggttcacgcgctgctccgtgat
ctgcactacgcgtcgtcgtctggcggccgacgagctatcgtgattaaggactacctgtcc
acggcgagcctgaacatgatcactcgcatggtgatgggcaagaggtacgtgcagggcgag
gtggtccatgaggagccgggatcggcgcggacgacgctggcgcagttcaaggagttgctc
gaagagctcttctttctcaacggcgtcttcaatgtcggcgaccagatcccgtggctcgag
tggttggacctacagggctacgtcaagaggatgaagaaggtgagcaaggcgttagaccag
cttctcgaacacgtcgtggacgagcacagtgagcggaggcaacgtgaggggaacgggttt
gtggcaggagacatggtggacgtgctccttcgactcgccgatgattctagcctcgaggtc
aaacttagtcgggacagcatcaaggcatttactcaggacctcattgctggcggcacggag
agttcatcggagacaatcgagtgggccatctcggagctcctcaggaagcccgagatgttt
gcaaaggccacagaggaattggatcgcattgtcggccatagacgttgggtcaacgagaag
gacattcttgatctcccctatattgaggctattgtaaaagagaccatgcgccttcaccct
atcggacctttgcttgcgccacgcctttcccgtgaggatacgtctgtgggtgggtatgac
atacctacgggcacgcgtgtattcgttaatgtgtgggccattgcccgtgaccctacgcta
tgggacgcatcggaggagttcatgccagagagattcttgggtaagaaaattgatgtgaaa
gggcaagactttgagctattaccatttgggtctggtcgacggatgtgcccaggctacaac
cttgggcttaaggtgatccaattgagcatagccaatctccttcatggcttcacgtggagg
ctcccgaaggacatggtaaaagaggatttgagcatggaggagatattcgggttatccatg
ccacgcaagttcccactagaggttgctgttgagcccaagctctctagtcacctctacaaa
ggtgattga

DBGET integrated database retrieval system