KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277854
Entry
107277854         CDS       T01015                                 
Name
(RefSeq) general transcription factor IIE subunit 1-like isoform X1
  KO
K03136  transcription initiation factor TFIIE subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    107277854
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    107277854
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     107277854
 Prokaryotic type
  Archaeal type
    TFE
     107277854
SSDB
Motif
Pfam: TFIIE_alpha Zn_ribbon_SprT Rrf2 Zn-ribbon_8 Sgf11 HTH_IclR HxlR TF_Zn_Ribbon HTH_Crp_2 VPS38 HAUS-augmin3 Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 107277854
NCBI-ProteinID: XP_015616545
LinkDB
Position
11:1735261..1742037
AA seq 422 aa
MASMEPLNRMVRMVARAFYDDVSLARDPKSARGDNCGLAVVVLEALGRRRQWVREEDLAK
ALKISSKQLRRILQFFEEEKLVRRCHRKEVYDVVRYRIHRMRKKLKDGLDDRDTVQHYVC
PNCKRRYSAFDALQLVSDMDDYFHCEHCKGELRPESEKLTLDEIVCGGGNAIKHTHDKLK
DMQQRMEEQLKPLIAVLDRVKDLPFPSFMSLQDWERATIGASANGAVGSSQNSEGRYSSK
PMPFLGETEVEVNFLGSTGAQEGVESGMESIKPQHSWMNRKRTVLAGEHKEENNNTANLD
QSSEAKSDKKQLSEEDEMKSIQEAYAKAYYEAIQKRQEDEGKRAIQEESLACISDQPFAS
DAQFERRLGAKSKRDDGGESGDDGIELKVRQSTGNIEEVYKFADLNVETQEVSCNDYEWE
EG
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcctccatggagcccttgaaccggatggtgaggatggtggcgcgcgcattctacgac
gacgtctcgctggccagagaccccaagtccgctcgcggcgacaactgtgggcttgccgtc
gttgtcctcgaagccctcggcaggcggcgccagtgggtccgagaggaagatttggctaaa
gcattaaagatttcctctaagcaactgcgccgcattctccagttttttgaagaagagaag
ctggtgagaagatgtcatcggaaggaggtgtatgatgttgtaagatataggatacaccgc
atgaggaaaaaattgaaagatggcttagatgacagagatacagttcagcattatgtgtgt
cctaattgtaaaagaaggtattcagcatttgatgcactgcaacttgtcagcgatatggat
gactattttcactgcgagcattgcaaaggagaacttcgtccagaaagtgaaaagcttact
ttggatgaaattgtgtgtggtggtggcaatgcaataaagcatacgcacgataaactgaag
gatatgcagcaaagaatggaggagcaattgaaaccactaatagcagtacttgacagggta
aaggatcttccttttccatcttttatgagtttgcaagattgggaaagagcaactataggg
gcatctgcaaatggtgcagttggttcatctcagaattcagaagggcgatacagcagtaaa
ccaatgcccttccttggggaaacagaggttgaagttaatttcttaggaagtactggtgca
caggaaggtgttgaatctggtatggaaagtataaagccacagcactcatggatgaatcgt
aagcgcacagtcctcgcgggggaacataaagaagaaaacaacaacactgcaaatctggat
caaagttcagaagccaagagtgacaagaaacagctctcagaggaagatgagatgaagagc
atacaggaggcatacgcaaaagcttattatgaggctatccagaaaaggcaggaagatgag
ggcaaaagggcgatacaagaagaaagcctagcatgtatttctgaccagccatttgcttct
gatgcacagtttgagaggcggttgggtgccaaatcaaaacgtgatgatggtggtgaatct
ggtgatgatggcattgaattgaaagtgaggcaatcaacaggaaatatagaagaggtatat
aagtttgctgatctgaatgtggagacccaagaagtaagttgtaatgattatgaatgggaa
gagggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278090
Entry
107278090         CDS       T01015                                 
Name
(RefSeq) general transcription factor IIE subunit 1-like
  KO
K03136  transcription initiation factor TFIIE subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    107278090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    107278090
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     107278090
 Prokaryotic type
  Archaeal type
    TFE
     107278090
SSDB
Motif
Pfam: TFIIE_alpha DUF3363 Rrf2 Sgf11 Zn_Tnp_IS1595 Zn_ribbon_SprT HTH_IclR Zn-ribbon_8 DiS_P_DiS
Other DBs
NCBI-GeneID: 107278090
NCBI-ProteinID: XP_015619125
LinkDB
Position
12:1691728..1712755
AA seq 490 aa
MASMEPLNRMVRMVARAFYDNVSLARDPKSARGDNCGLAVVVLDALTRRRQWVREEDLAK
ALKISSKQLRRILQFFEEEKLVRRCHRKESPKGVNISNNVSGTAGDVHPFTKGGEKAKMH
THSYCCLDYAQVYDVVRHRIHRMRKKLKDELDDRDTVQHYVCPNCKRRYSAFDALQLVSD
MDDYFHCEHCKEQLLPESEKLTLDEVVCGGDNAIKHKHDKLKDMQQRMEEQLKPLIAVLD
RVKDLPFPSFMSLQDWERATMEASANGAVGSSQNSEGRYSSKPMPFLGETEVEVNFLGST
GAQEGVESGMESIKPQPSWMNRKSTVLTGEHKGEISNTADLDQSSEAKSDKKQLSEKDEM
KSIQEAYAKAYYEAIQKRQEDEDKRMIQEESLTCISDQPFASDAQFERRLGAKSKRDDGG
DSGDDGIEMKVEQPTGNIGEVYKLADLDVETQESIDDDDDDDLVWDSRTDGSKFDTSSPI
EWEVQNVWKV
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggcctccatggagcccttgaaccggatggtgaggatggtggcgcgcgcattctacgac
aacgtctcgctggccagagaccccaagtccgctcgcggcgacaactgtgggcttgccgtc
gttgtcctcgacgccctcaccaggcggcgccagtgggtccgagaggaagatttggctaaa
gcattaaagatttcctctaagcaactgcgccgcattctccagttttttgaagaagagaag
ctagtgagaagatgtcatcggaaggagtcaccaaaaggagtaaacatatctaacaatgtc
tctggcaccgctggtgatgtgcatccttttactaaaggaggagagaaagcaaagatgcac
acacattcctactgttgtttggactatgctcaggtatatgatgttgtaagacataggata
caccgcatgaggaaaaaattaaaagatgagttagatgacagagatacagttcagcattat
gtatgtcctaactgtaaaagaaggtattcagcatttgatgcactgcaacttgtaagcgat
atggatgactattttcactgtgagcattgcaaagaacaacttcttccagaaagtgaaaag
cttactttggatgaagttgtgtgtggtggtgacaatgcaataaagcataagcacgataaa
ctaaaggatatgcagcaaagaatggaggagcaattgaagccattaatagcagtacttgac
agggtaaaggatcttccttttccatcttttatgagtttgcaagattgggaaagagcaact
atggaggcatctgcaaatggtgcagttggttcatctcagaattcagaagggcgatacagc
agtaaaccaatgcccttccttggggaaacagaggttgaagttaatttcttaggaagtact
ggagcacaggaaggtgttgaatctggtatggaaagtataaagccacagccctcatggatg
aatcgtaagagtacagtcctcacaggggaacataaaggagaaatcagcaacactgcagat
ctggatcaaagttcagaagccaagagtgacaagaaacagctctcagagaaagatgagatg
aagagcatacaggaggcatatgcaaaagcttattatgaggctatccagaaaaggcaggaa
gatgaggacaaaaggatgatacaagaagaaagccttacatgtatttctgaccagccattt
gcttctgatgcacagtttgagaggcggttgggtgccaaatcaaaacgtgatgatggtggt
gactctggtgatgatggcattgaaatgaaagtggagcaaccaacagggaatataggagag
gtatataagttggctgatctggatgtggagacccaagaatcaattgatgatgatgatgat
gatgatcttgtttgggacagtaggactgatggctccaagtttgatacatcatcaccaatt
gagtgggaagtgcaaaatgtgtggaaggtttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345330
Entry
4345330           CDS       T01015                                 
Name
(RefSeq) general transcription factor IIE subunit 1
  KO
K03136  transcription initiation factor TFIIE subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4345330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4345330
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     4345330
 Prokaryotic type
  Archaeal type
    TFE
     4345330
SSDB
Motif
Pfam: TFIIE_alpha TF_Zn_Ribbon DiS_P_DiS Zn-ribbon_8 ABC2_membrane_7
Other DBs
NCBI-GeneID: 4345330
NCBI-ProteinID: XP_015650861
UniProt: A3BS58 Q6ZB67
LinkDB
Position
8:15494243..15501844
AA seq 462 aa
MGSMEPFNRLVRLAARAFYDDISMKGDNQPKTSRGDNRGMAVVVLDALTRRQWVREEDLA
KALKLHSKQLRRILRFFEEEKLVTRDHRKESAKGAKIYSAAAAAAGDGQSITKEGEEKVK
MHTHSYCCLDYAQICDVVRYRIHRMKKKLKDELDSRNTIQHYICPNCKKRYSAFDALQLI
SYTDEYFHCENCNGELVAESDKLASEEMGDGDDNARKRRREKLKDMQQRIDEQLKPLQAQ
LNRVKDLPAPEFGSLQSWERANIGAFGTADPSAADSSRNPQGQYGTPMPYLGETKVEVAL
SGTGVKDEGAESGTNGNGLKVLPPWMIKQGMNLTKEQRGETSNSSNLDEKSEVKDEKKQD
SKEDEKSIQDEYIKAYYEALRKRQDEEEAKRKIQQEGDTFASASHSERQVGMKSKREDDD
EGVEWEEEQPAGNTAETYKLADLNVEAQESGDEEDEIDWEEG
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggctccatggagccgttcaaccggctggtgaggctggcggcgcgcgccttctacgac
gacatctcgatgaagggcgacaaccagcccaagacctcccgcggggacaaccgggggatg
gctgtcgtcgtcctcgacgcgctcaccagacgccaatgggttcgagaggaggatttggct
aaggcattgaaactccactcaaagcaattgcgccgtatcctccgattctttgaagaagag
aaactagtgacacgagatcaccggaaggagtcagcaaaaggagcaaaaatatacagtgca
gcagctgcagctgctggtgatggtcaatcaattaccaaggagggagaagagaaagtaaag
atgcatacccactcgtactgttgcttggactatgcacagatctgtgatgttgtaaggtat
cggatacatcgcatgaagaaaaagttgaaagatgaattggacagcagaaatacaatccaa
cactatatatgccctaactgtaagaaaaggtattcagccttcgatgcattacagcttata
agctacaccgatgagtacttccattgcgaaaattgcaatggtgagctagttgcagagagt
gacaagcttgcttctgaggaaatgggagatggtgatgataatgcaagaaaacgccggcgt
gagaaactaaaggatatgcagcaaaggatcgatgaacaattgaagccattgcaagcacaa
cttaatagggtgaaggatcttcctgctcctgagtttgggagcttacaatcatgggaaaga
gctaacattggtgcttttggaactgctgaccctagtgctgctgactcgtctaggaaccca
caagggcagtatggtacaccaatgccatacctcggagagacaaaggttgaagttgcattg
tctggcaccggtgtaaaagatgaaggtgctgaatcaggtacaaatggtaacgggctgaaa
gtcttgcctccatggatgatcaaacaaggtatgaatcttacaaaagaacaaagaggagag
accagtaactcatcaaatctagatgaaaaatcagaagtcaaggatgagaaaaaacaggac
tcaaaagaagatgagaagagtatacaggatgaatacataaaggcttattatgaggcctta
aggaaaagacaggacgaagaagaagcgaaaaggaagatacagcaggaaggggatacattt
gcttctgcgtctcattctgaacggcaggtgggcatgaaatccaaacgagaggatgatgat
gagggtgttgaatgggaagaagagcaacctgcagggaatacagctgagacatacaaactg
gcagatttgaatgttgaagcccaagaatctggtgatgaagaagatgaaattgactgggaa
gagggttaa

DBGET integrated database retrieval system