KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277936
Entry
107277936         CDS       T01015                                 
Name
(RefSeq) phospholipase A(1) DAD1, chloroplastic-like
  KO
K16818  phospholipase A1 [EC:3.1.1.32]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107277936
   00592 alpha-Linolenic acid metabolism
    107277936
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     107277936
SSDB
Motif
Pfam: Lipase_3 Mbeg1-like PGAP1
Other DBs
NCBI-GeneID: 107277936
NCBI-ProteinID: XP_015616106
LinkDB
Position
11:2110691..2112019
AA seq 286 aa
MRIGRQWTELQGARDWDGLLNPLDGALRGELVRYGEFVRAAYASFDFDGGAPSSYGSCRF
PTSSLLRRSGLPETGYRVTGILHAASTSAPGWLSCRSSYIGYVAVCDDEDEIERLGRRDV
VIAFRGTATCGEWVDNFKSTLTHLPPRSGDGEAAPPMVESGFWRLFTTPGEAHGSLQQQV
RGEVQRIVSEYGGEGMPPLSITVTGHSLGAALAVLTAYDITTNSPMQRHGGGDDDDGEAP
MVTAVSFGGPRVGNAAFRRRLEESGGKVLRVVNSNDVVTKVPGEQE
NT seq 861 nt   +upstreamnt  +downstreamnt
atgcggattggcaggcagtggacggagctccagggtgctcgtgattgggacggcctgctt
aacccgctcgacggcgcgctccggggcgagctcgtccgctacggcgagttcgtccgcgcc
gcgtacgccagcttcgacttcgacggcggcgcgccgtcgtcgtatgggtcgtgccggttt
ccgaccagctccctgctgcgccgctccgggctccctgagactggctaccgggtcaccggg
atcctccacgccgcgtcgacgtcggcgccgggctggctgtcgtgcaggtccagctacatt
gggtacgtcgcggtgtgcgacgacgaggacgagatcgagcggctgggtcgccgcgacgtc
gtcattgcgttccgcggcacggcgacgtgcggcgagtgggtggacaacttcaagtccact
ctcacccacctgccgccgcgatccggcgacggcgaggcggcgccgccgatggtggagagt
ggattctggaggctcttcaccaccccgggcgaagcgcacggcagcctgcagcaacaagtg
cgcggcgaggtgcagcggatcgtcagcgagtacggcggcgagggcatgccgccgttgagc
atcacggtcaccggacacagcctcggcgccgcgctcgcggtgctcaccgcctacgacatc
acgacaaactcccccatgcaacgccacggcggcggcgacgacgacgacggcgaggcgccg
atggtgaccgccgtgtcgttcggcgggccgcgcgtgggcaacgcggcgttccggcgaagg
ctggaggagagcggcggcaaggtgctccgcgtggtgaactcgaacgacgtcgtgaccaag
gtgccgggagaacaggaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336987
Entry
4336987           CDS       T01015                                 
Name
(RefSeq) lecithin-cholesterol acyltransferase-like 4
  KO
K22389  phospholipase A1 [EC:3.1.1.32]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4336987
   00592 alpha-Linolenic acid metabolism
    4336987
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     4336987
SSDB
Motif
Pfam: LCAT PGAP1 DUF676 DUF915 Abhydrolase_1 Abhydrolase_6 Lipase_2 DUF900 Hydrolase_4
Other DBs
NCBI-GeneID: 4336987
NCBI-ProteinID: XP_015636267
UniProt: Q7XTS6 B9FCH4
LinkDB
Position
4:31215137..31220372
AA seq 533 aa
MAVLEDLIRAIELWLRIAKEQVPLVDPTLDPVLLVPGIGGSILEAVDEAGKKERVWVRIL
AADHEFRAHLWSKFDASTGKTVSVDEKTNIVVPEDRYGLYAIDTLDPDMIIGDDSVCYYH
DMIVQMIKWGYQEGKTLFGFGYDFRQSNRLSETLDRFSRKLESVYIASGEKKINLITHSM
GGLLVKCFMSLHSDVFEKYIKSWIAIAAPFQGAPGYITTSLLNGMSFVEGWESRFFISKW
SMQQLLLECPSIYELLANSTFQWEDTPYLQIWRQKLDTNGKKSAMLESYEPDEAIKMIRE
ALSKHEIISDGMHIPLPLDMDILRWAKETQDVLCNAKLPKSVKFYNIYGTDYDTAHTVRY
GSEHHPISNLSDLLYTQGNYICVDGDGSVPVESAKADGLDAVARVGVAADHRGIVCDRHV
FRIIQHWLHAGEPDPFYDPLNDYVILPTAFEIEKYHEKHGDITSVREDWEIISHRDDESK
RPAELPPMFNTLSASREGEDGSLEEAQATIFVHPESKGRQHVEVRAVGVTHDG
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggctgtgctggaggatttgatcagggcgattgagctctggctgcggattgctaaggag
caggtacccttggtggatccaacccttgacccggttctgcttgtccccggcataggcggc
tcgattcttgaagccgttgatgaggccgggaagaaggagagggtgtgggtgcgcatcctc
gctgcggatcatgagtttcgagcacatctctggtccaagtttgatgcttccactgggaaa
actgtctctgtcgatgagaaaacaaatattgttgtccctgaggatagatatggactatac
gctattgacactctggaccccgacatgatcattggcgatgatagtgtttgctactatcac
gacatgatagtgcaaatgatcaaatggggataccaagaggggaaaacattatttggattt
ggttatgatttccgccagagtaacaggctttcagaaacacttgatagattttccagaaag
ttggagtcagtttacatagcttccggagaaaaaaagatcaatctcattactcattcaatg
ggaggattgcttgtcaaatgcttcatgtccctccatagtgatgtcttcgagaaatacata
aagagttggattgcaattgctgcaccatttcaaggtgcacctgggtacataactactagt
ctgctgaatggtatgtcttttgtcgaaggatgggagtcaagattctttatttccaagtgg
agtatgcagcaattgttgctcgaatgcccatcaatttacgaattgttggctaactcgacc
ttccaatgggaagatactccatatctgcagatctggagacagaaattggatactaatggc
aagaaaagtgccatgttagagtcatatgagccagatgaagcaataaaaatgattagagaa
gctctttccaagcatgagatcatttctgatggtatgcacattccattgccccttgatatg
gatatattgagatgggcaaaagagacacaggatgttttgtgcaatgcaaagcttccaaaa
tcagtgaagttctacaatatttacggaactgattatgacactgcccataccgttcgctac
gggagtgaacaccatccaatttcaaatctcagtgacctcttgtatactcagggcaactac
atctgtgttgatggtgatggatctgtccctgtagaatcagcaaaggcagatggcctcgat
gcagtggcaagagttggggttgctgcagaccaccgaggaatcgtctgtgatcgtcacgtg
ttccggataattcagcactggctccatgccggtgagcctgacccattctacgatcccctc
aacgactacgtcatactcccaacagccttcgagatcgagaagtaccacgagaaacacggg
gatatcacatcggttagagaggactgggagatcatctcccatcgcgatgacgaaagcaag
aggccagccgagcttcctcctatgttcaacacgctatcggcgtcccgcgagggtgaagac
ggctcgctggaagaggcgcaggcgacgatctttgttcatccagagagcaaagggaggcag
catgtggaagttagggcagttggagtcacccatgacggctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269832
Entry
9269832           CDS       T01015                                 
Name
(RefSeq) phospholipase A(1) LCAT3 isoform X1
  KO
K22389  phospholipase A1 [EC:3.1.1.32]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    9269832
   00592 alpha-Linolenic acid metabolism
    9269832
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     9269832
SSDB
Motif
Pfam: LCAT PGAP1 DUF915 Hydrolase_4 Abhydrolase_1 Lipase_2 DUF676 Abhydrolase_6 DUF900
Other DBs
NCBI-GeneID: 9269832
NCBI-ProteinID: XP_015612689
UniProt: B9EY64
LinkDB
Position
9:19965092..19970152
AA seq 471 aa
MAVLGVGAAVRLRLRVLGRHLRLRGRRRTRRRRGGGGVEDEEEGGREAVVLVSGMGGSVL
HARRRSNPRFDLRVWVRILRADADFRKYLWSLYNPDTGYVEPLDDDVEIVVPEDDHGLFA
IDILDPSWFVEILHLSMVYHFHDMIDMLVDCGYKKGTTLFGYGYDFRQSNRIDKVMVGLR
AKLETAYKASGGKKVNIISHSMGGLLVSCFMSMNRDIFAKYVNKWICIACPFQGAPGCIN
DSLLTGLQFVYGFESFFFVSRWVMHQLLVECPSIYEMLPNPHFKWKKAPVVQVWRKKPEK
DGIAELVLYEATDCLSLFQEALRNNELKYNGKTIALPFNMSVFKWATETRRILEDAELPD
TVSFYNIYGTSYDTPYDVCYGSESSPIGDLSEVCHTMPVYTYVDGDGTVPIESTMADGFA
AKERVGIEADHRGLLCDENVFELLKKWLGVKEESTRRRRLSKSKVTDFAPS
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggccgtgctgggagtgggcgccgccgtcaggctgcggctccgcgtgctcggccgccac
ctccgcctccgcgggcgcaggcgcacgcggcggcggcggggaggtggtggggtggaggat
gaggaggaaggagggagggaggcggtggtgctggtgtccgggatgggcgggtcggtgctg
cacgcgcggcggcggtcgaaccccaggttcgacctccgcgtctgggtgcgcatcctccgc
gccgacgccgacttcaggaagtacctctggtcgctctacaaccccgacaccgggtacgtg
gagccgttggacgacgatgtggagatcgtggtgccggaggacgaccacggcctgttcgcc
atcgacattctcgatccttcctggtttgtggagattctccatctgtctatggtgtatcac
tttcatgatatgattgatatgcttgttgactgtggatacaagaaaggaaccacacttttt
ggatatggttatgattttcgccaaagtaacaggatagacaaagtgatggttggtttgcga
gcaaaacttgagacagcttataaggcttctggtgggaaaaaggttaatataatatcgcat
tctatgggtggactgctagtgagctgcttcatgtctatgaaccgtgatatatttgcgaaa
tatgtgaacaaatggatttgtattgcatgtccatttcaaggtgccccaggatgcatcaat
gattctctgctaactgggctacaatttgtttatgggtttgaaagcttcttttttgtttct
agatgggtgatgcatcaactgcttgttgaatgcccatccatctacgaaatgctgccaaat
ccacatttcaagtggaagaaagcaccagttgttcaggtttggagaaagaaacctgaaaag
gatggaatagcggagttagttctgtatgaagctaccgattgtttatctctgtttcaagaa
gctttaaggaacaatgagctcaagtataatgggaagacaattgcactgccattcaatatg
tcagtcttcaagtgggccactgagacccgccgaattcttgaggatgctgaattaccagat
actgtgagcttttataatatatatgggacatcttacgatactccatatgatgtttgttac
ggctctgaaagctccccaattggagatctgtcagaagtgtgccacacaatgccagtgtac
acttatgtggatggagatggcacagttcctattgagtcaactatggctgatggatttgca
gccaaggaaagagttggcatcgaggccgaccaccgagggctgctttgcgacgagaatgtg
tttgagcttctgaagaaatggctcggcgtgaaggaagaaagcacacggcggcgtcggttg
tccaagtccaaagtgacagactttgcaccatcataa

DBGET integrated database retrieval system