KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278041
Entry
107278041         CDS       T01015                                 
Name
(RefSeq) respiratory burst oxidase homolog protein B-like
  KO
K13447  respiratory burst oxidase [EC:1.6.3.- 1.11.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107278041
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107278041
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-
     107278041
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-
     107278041
SSDB
Motif
Pfam: NAD_binding_6 NADPH_Ox FAD_binding_8 Ferric_reduct EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 DUF2666
Other DBs
NCBI-GeneID: 107278041
NCBI-ProteinID: XP_015616929
UniProt: Q2R351
LinkDB
Position
11:complement(19588996..19596490)
AA seq 936 aa
MHHTRAGAADGAGGGGEDIVEAGAEAPPPQRERLVPHSGPLSKRSGMRKSARFAESVSAP
LSAPSGVAAARRAAAAANDDDEEDYVEITLDVRDDSVAVHSVKPAGGGGEDSDVTLLART
LEKRSSSFGHSVIRNASSRIKQVSQELRRLASVNRRGGGGGGPRFDRSKSAAAHALKGLK
FISRADGGAGWPAVEKRFDDLAKDGLLPRSKFGQCIGMKELEFAGELFDALARRRNISGD
SISKAELLEFWDQISDTSFDSRLQTFFDMVDKNADGRITEEEVKEIITLSASANKLSKVQ
EQSEEYARLIMEELDPSNLGYIELYNLEMLLLQAPSQSVRIGTTNSRNLSQMLSQNLRPT
AEPNPLRRWWRRASYFLEDNWRRVWVLLLWLAICAGLFTYKFIQYRHRAVFHVMGYCVCV
AKGGAETLKFNMALILLPVCRNTVTWIRNRAAVARVVPFDDNLNFHKVIAVGITVGAGLH
VISHLTCDFPRLLHATDAEYEPMKRFFGDTRPPNYWWFVKGTEGWTGLVMLVLMAVAFTL
ATPWFRRGRLRLPRPLNRLTGFNAFWYSHHCFVIVYALLIVHGYYLFLTKDWYKKTTWMY
LAVPMFLYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFKYKSGQYIFVNCA
AVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSGLLRAEYDR
DGAMTNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQLDGD
LEDGDGNDNSVSSSSAAFKTRRAYFYWVTREQGSFEWFRGVMDEVAETDKKGVIELHNYC
TSVYEEGDARSALIAMLQSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHRDQRV
GVFYCGAPVLTKELRELAQDFSRKTSTKFDFHKENF
NT seq 2811 nt   +upstreamnt  +downstreamnt
atgcaccataccagggctggcgccgccgatggcgccggcggcggaggagaggacatcgtg
gaggccggggcggaggcgccgccgccgcagagggagcggctggtgccgcacagcgggcca
ctgagcaagaggtccgggatgaggaagagcgcgaggttcgcggagtcggtgtcggcgccg
ctgtccgcgccgtcgggggtggcggcggcgcggcgcgccgccgccgccgccaacgacgac
gacgaggaggactacgtggagatcaccctcgacgtgcgcgacgactcggtggcggtgcac
agcgtgaagccggcgggcggcggcggcgaggactcggacgtgacgctgctggcgcggacg
ctggagaagcggtcgtcgtcgttcggccactcggtgatccggaacgcgtcgtcgcggatc
aagcaggtgtcgcaggagctccgccgcctcgcctccgtcaaccgccgcggcggcggcggc
ggcggtccccgcttcgaccgctccaagtccgccgccgcccacgccctcaagggcctcaag
ttcatcagccgcgccgacggcggcgccggctggcccgccgtcgagaagcgcttcgacgac
ctcgccaaggacggcctcctcccccgctccaagttcggccagtgcatcgggatgaaggag
ctggagttcgccggcgagctgttcgacgcgctggcgaggcggcggaacatctccggcgac
agcatcagcaaggcggagctgctggaattctgggaccaaatctccgacaccagcttcgac
agccgtctccaaaccttcttcgacatggtggacaagaacgcggatggcaggatcacagaa
gaggaggttaaagagattatcacgctgagcgcgtcggccaacaagctgtccaaggtgcag
gagcagtccgaggagtacgctcgcctcatcatggaggagctcgaccccagcaacctcggc
tacatcgagctgtacaacctggagatgctgctgctgcaagcgccgagccagtcggtgagg
atcgggacgacgaacagccggaacctgagccagatgctgagccagaacctccggccgacg
gcggagcccaacccgctccggcggtggtggcggcgcgcctcctacttcctcgaggacaac
tggcgccgcgtctgggtgctcctcctgtggctcgccatctgcgcgggcctcttcacctac
aagttcatccagtaccggcaccgcgccgtgttccacgtcatgggctactgcgtctgcgtc
gccaagggcggcgccgagacgctcaagttcaacatggcgctcatcctcctcccggtgtgc
cggaacaccgtcacctggatccgcaaccgcgccgccgtcgcccgcgtcgtgccgttcgac
gacaacctcaacttccacaaggtgatcgccgtggggatcaccgtgggggccgggctgcac
gtcatctctcaccttacctgcgattttccacggctgctccatgccaccgacgccgagtac
gagccgatgaagaggttcttcggcgacacgcggccgcccaactactggtggttcgtgaag
gggacggaggggtggacggggctggtgatgctggtgctcatggcggtggcgttcaccctc
gccacgccgtggttccgccgcggccgcctccgcctcccccgcccgctcaaccgcctcacg
gggttcaacgccttctggtactcccaccactgcttcgtcatcgtctacgccctcctcatc
gtccacggctactacctcttccttaccaaggattggtacaagaaaacgacgtggatgtac
ctggcggtgccgatgttcctgtacgcgtgcgagaggctgacgagggcgctccggtcgagc
gtgaggccagtgaagatactcaaggttgcggtgtaccccggaaatgtgctgtcgctgcac
ttctccaagccacagggtttcaagtacaagagtgggcagtacatcttcgtcaactgtgcc
gccgtctcgccgttccaatggcacccattctccatcacgtcggccccacaggacgactac
gtcagcgtccacatcaggacgctcggtgactggacacgggagcttaagaacgtcttctca
agggtctgccggccaccgacggaagggaagagcgggttgctccgggcggagtacgaccgc
gacggcgccatgaccaacccaagcttccccaaggtgcttatcgacgggccgtacggcgca
ccggcgcaggactacaagcagtacgacatcgtcctcctcgtcggcctcgggatcggcgcc
accccgatgatctccatcatcaaggacatcataaacaacatgaggcagctggacggcgac
ctcgaggacggcgacggcaacgataactcggtgtcgtcgtcgtcggcggcgttcaagacg
cggcgcgcctacttctactgggtgacgcgggagcaggggtcgttcgagtggttccggggg
gtgatggacgaggtggcggagacggacaagaagggggtgatcgagctgcacaactactgc
accagcgtgtacgaggaaggggacgcccggtcggcgctcatcgctatgctccagtcgctc
aaccacgccaagcacggcgtcgacgtcgtctccggcacccgcgtcaagacccacttcgcc
cgccccaactggcgcaacgtctacaagcgcatcgccctcaaccaccgcgaccaacgcgtc
ggggtgttctactgtggcgcgccggtgctgacgaaggaactgcgtgagctcgctcaagat
ttctcgagaaagacgagcacgaaattcgacttccacaaggagaatttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324163
Entry
4324163           CDS       T01015                                 
Name
(RefSeq) respiratory burst oxidase homolog protein A
  KO
K13447  respiratory burst oxidase [EC:1.6.3.- 1.11.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4324163
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4324163
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-
     4324163
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-
     4324163
SSDB
Motif
Pfam: NAD_binding_6 NADPH_Ox FAD_binding_8 Ferric_reduct EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 MPS2
Other DBs
NCBI-GeneID: 4324163
NCBI-ProteinID: XP_015621414
LinkDB
Position
1:30621870..30634405
AA seq 943 aa
MRGGASSGPQRWGSAGTTPRSLSTGSSPRGSDDRSSDDGEELVEVTLDLQDDDTIVLRSV
EPAAAAAAGVGAGAGAASARGELTGGPSSSSSRSRSPSIRRSSSHRLLQFSQELKAEAMA
RARQFSQDLTKRFGRSHSRSEAQAPSGLESALAARAARRQRAQLDRTRSGAHKALRGLRF
ISSNKANNAWMEVQANFDRLARDGYLSRSDFAECIGMTESKEFALELFDTLSRRRQMKVD
TINKDELREIWQQITDNSFDSRLQIFFEMVDKNADGRITEAEVKEIIMLSASANKLSRLK
EQAEEYAALIMEELDPEGLGYIELWQLETLLLQKDTYMNYSQALSYTSQALSQNLAGLRK
KSSIRKISTSLSYYFEDNWKRLWVLALWIGIMAGLFTWKFMQYRNRYVFDVMGYCVTTAK
GAAETLKLNMAIILLPVCRNTITWLRSTRAARALPFDDNINFHKTIAAAIVVGIILHAGN
HLVCDFPRLIKSSDEKYAPLGQYFGEIKPTYFTLVKGVEGITGVIMVVCMIIAFTLATRW
FRRSLVKLPRPFDKLTGFNAFWYSHHLFIIVYIALIVHGECLYLIHVWYRRTTWMYLSVP
VCLYVGERILRFFRSGSYSVRLLKVAIYPGNVLTLQMSKPPTFRYKSGQYMFVQCPAVSP
FEWHPFSITSAPGDDYLSIHVRQLGDWTRELKRVFAAACEPPAGGKSGLLRADETTKKIL
PKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLLNNIIKMEEEEDASTDLYP
PMGRNKPHVDLGTLMTITSRPKKILKTTNAYFYWVTREQGSFDWFKGVMNEIADLDQRNI
IEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDIVSGTKVRTHFARPNWRKVLSKISS
KHPYAKIGVFYCGAPVLAQELSKLCHEFNGKCTTKFEFHKEHF
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgaggggcggcgcctcctcgggaccccagcgatggggctcggcggggacgacaccgcgg
tcgctgagcacgggctcgtcgccgcgcgggtccgacgaccggagctccgacgacggggag
gagctggtcgaggtcacgctcgacctgcaggacgacgacaccattgtgcttcggagcgtc
gagcccgcggcggcggcggcggcgggggtgggggcgggggcgggggcggcgtcggcgcgg
ggggagctcacgggtggcccgtcgtcgtcgtcgtcgcggtcgaggtcgccgtcgatccgg
aggagctcgtcgcaccggctgctgcagttctcgcaggagctcaaggcggaggccatggcc
cgggcgcggcagttctcgcaggacctgaccaagcggttcggccgcagccacagccgcagc
gaagcgcaggcgccgtcgggcctcgagtccgcgctcgccgcccgcgccgcgcggcggcag
cgcgcgcagctcgaccgcacacgctccggcgcccacaaggcgctccgcggcctccgcttc
atcagcagcaacaaggccaacaacgcctggatggaggtgcaggccaacttcgaccgcctc
gcccgcgacggctacctctcccgctccgacttcgccgaatgcatcgggatgacggaatcg
aaggagttcgcgctcgagctgttcgacacgctgagccggcgacgacagatgaaggtggac
acgattaacaaggatgaactccgcgagatctggcagcagatcaccgataacagcttcgac
tcccgtctccaaatcttcttcgaaatggtggataagaacgcggacggccggattacggag
gcggaggtgaaagagattattatgttgagcgcgtctgccaataaactgtcgaggcttaag
gagcaagcagaagagtacgccgctttgatcatggaggagcttgatcctgaagggctcggc
tacattgagctatggcaattggagacacttctgttgcagaaagatacctatatgaactat
agtcaggcccttagttacacaagccaagcactgagccagaatcttgcagggctaaggaag
aagagttcaatccgcaaaataagcacctctttaagctactatttcgaggacaactggaaa
cgtttatgggtgcttgcattgtggattgggataatggctggactgttcacctggaaattc
atgcagtatcgtaaccgatatgtctttgatgtgatgggctactgtgtcacaacagcaaaa
ggagctgctgaaaccctaaagctgaatatggcaattatcctcctgccagtatgccgtaac
accattacttggttgcgaagtacaagggctgcacgggcactaccttttgatgacaacatc
aacttccacaagactattgcagcagcaattgtggttggtataatcctccatgcagggaac
caccttgtatgcgattttccacggttaataaaatcatcagatgagaagtatgctcctttg
ggccagtattttggggaaataaagccaacatattttacattggtcaaaggagtggagggc
atcactggggtaatcatggttgtatgcatgataattgcttttactctagcaacccggtgg
ttccgccgtagcttggttaagcttccaaggccatttgacaaactgactggcttcaatgcc
ttttggtattctcatcatctgttcatcattgtgtatatcgcgctcattgttcatggagag
tgtctataccttattcatgtctggtacagaagaacgacatggatgtatctttcagtgcct
gtttgcttgtatgtaggggagaggattctaaggttcttcaggtctggcagttattctgtc
cggctattgaaggtggccatatatccaggtaatgttttgacactgcaaatgtccaagcct
cccacgttccgttacaagagtggacaatatatgtttgttcaatgtccagcagtgtctccc
tttgaatggcatcccttctcaattacttcagcacctggggatgactacctcagcattcat
gttcgacaacttggtgattggacacgagaactcaagagagtatttgctgcagcttgtgag
cccccagcgggtggtaaaagcggccttcttagggcagatgagacaactaagaaaatctta
cccaagcttctgattgatggaccgtatggttctcctgctcaggattacagcaagtatgat
gttttattacttgttggattaggaattggtgcgacaccctttattagcatattaaaagat
cttctgaataacatcatcaaaatggaggaagaggaggatgcttctactgatctttatcca
ccaatgggtcggaataagccacatgttgatctgggcacacttatgacgattacctcaaga
ccaaagaagatcttgaagaccacaaatgcttacttttactgggtgacacgtgagcaaggc
tcttttgattggttcaaaggagtcatgaatgaaattgctgacttggatcaaaggaatatc
attgagatgcacaactacctaacaagcgtctatgaggagggggatgccaggtcagcactc
atcaccatgctccaagctctgaaccatgccaagaatggagttgatattgtctctgggaca
aaagtccggacacattttgcacgaccaaattggagaaaggtcctttctaaaatttcctcc
aagcatccatatgccaaaataggtgtattctactgtggagctccagtcctggcacaagaa
ctaagcaaactttgccatgaattcaacgggaaatgcacaacgaagttcgaattccataag
gagcatttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326027
Entry
4326027           CDS       T01015                                 
Name
(RefSeq) respiratory burst oxidase homolog protein B
  KO
K13447  respiratory burst oxidase [EC:1.6.3.- 1.11.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4326027
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4326027
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-
     4326027
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-
     4326027
SSDB
Motif
Pfam: NAD_binding_6 NADPH_Ox FAD_binding_8 Ferric_reduct EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5
Other DBs
NCBI-GeneID: 4326027
NCBI-ProteinID: XP_015620905
UniProt: Q5ZAJ0
Structure
LinkDB
Position
1:complement(14621295..14627952)
AA seq 905 aa
MADLEAGMVAAATDQGNSTRSQDDAATLIPNSGNLGSSNRSTKTARFKDDDELVEITLDV
QRDSVAIQEVRGVDEGGSGHGTGFDGLPLVSPSSKSGKLTSKLRQVTNGLKMKSSSRKAP
SPQAQQSAKRVRKRLDRTKSSAAVALKGLQFVTAKVGNDGWAAVEKRFNQLQVDGVLLRS
RFGKCIGMDGSDEFAVQMFDSLARKRGIVKQVLTKDELKDFYEQLTDQGFDNRLRTFFDM
VDKNADGRLTAEEVKEIIALSASANKLSKIKERADEYTALIMEELDPTNLGYIEMEDLEA
LLLQSPSEAAARSTTTHSSKLSKALSMKLASNKEMSPVRHYWQQFMYFLEENWKRSWVMT
LWISICIALFIWKFIQYRNRAVFGIMGYCVTTAKGAAETLKFNMALVLLPVCRNTITWIR
SKTQVGAVVPFNDNINFHKVIAAGVAVGVALHAGAHLTCDFPRLLHASDAQYELMKPFFG
EKRPPNYWWFVKGTEGWTGVVMVVLMAIAFTLAQPWFRRNKLKDSNPLKKMTGFNAFWFT
HHLFVIVYTLLFVHGTCLYLSRKWYKKTTWMYLAVPVVLYVSERILRLFRSHDAVGIQKV
AVYPGNVLALYMSKPPGFRYRSGQYIFIKCTAVSPYEWHPFSITSAPGDDYLSVHIRTRG
DWTSRLRTVFSEACRPPTEGESGLLRADLSKGITDEKARFPKLLVDGPYGAPAQDYREYD
VLLLIGLGIGATPLISIVKDVLNHIQGEGSVGTTEPESSSKAKKKPFMTKRAYFYWVTRE
EGSFEWFRGVMNEVSEKDKDGVIELHNHCSSVYQEGDARSALIVMLQELQHAKKGVDILS
GTSVKTHFARPNWRSVFKKVAVSHENQRVGVFYCGEPVLVPQLRQLSADFTHKTNTRFDF
HKENF
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggctgacctggaagcaggcatggttgctgctgccacagaccagggcaattcaacaagg
tcacaagatgacgcagccacactgatcccgaacagtggcaatctgggctcgagcaacagg
agcaccaagacggccaggttcaaggacgacgacgagctggtcgagatcaccctcgacgtg
cagcgcgattcggtggcaatccaagaagtgagaggggtggatgagggtggctccgggcac
ggtaccgggttcgacggcctgccactggtgtcaccctcgtcgaagagcggaaagctgacg
tcaaagctcaggcaggtgaccaatgggctcaagatgaagagctccagcaggaaggcgcca
tccccgcaggcgcagcagtctgcgaagagggtgaggaagaggctggacaggaccaagagc
agcgccgccgtggcgctcaaaggattgcagtttgtgactgcaaaggttggcaatgacggc
tgggccgcggtggagaagcggttcaatcagctgcaggtggatggtgtgctgctccgttca
agatttgggaaatgcattggaatggatgggtccgacgagtttgcggtgcaaatgttcgat
tctctggcgaggaagagagggatagtgaagcaggtgctcactaaggacgagctcaaagat
ttctatgagcaattgactgatcaggggtttgacaatcgtcttcggacattctttgacatg
gttgacaagaacgctgatggaaggctcacagcagaagaggttaaggagattattgccctt
agtgcatcagcaaacaaactttccaagatcaaggagcgagctgatgagtacacagcactc
attatggaagagcttgaccctacaaacttgggatacatcgagatggaggacttggaagca
ctattgcttcagtcaccatctgaagctgctgcaagatcaacaacgacgcacagctccaaa
cttagcaaagctcttagcatgaagcttgcgtctaacaaagaaatgagcccagttcgtcat
tactggcagcagttcatgtacttccttgaagagaattggaagcgcagttgggttatgact
ctgtggatctcaatctgcattgcccttttcatttggaagttcattcagtaccgtaatcga
gccgtattcggcatcatgggttattgtgtgaccactgcaaagggtgctgcagagaccctc
aaattcaacatggctttggtcctacttcctgtctgcagaaatacaatcacatggattcgg
tcaaagacacaggttggagctgttgtacccttcaacgacaatataaactttcataaggtc
atagccgcaggtgttgcagttggtgttgctttgcatgcaggtgctcatctgacatgtgat
tttccccggctgctccatgcgagtgatgcacaatatgaactaatgaagcccttctttggg
gagaagaggccaccaaattactggtggtttgtaaagggaactgaaggctggacaggtgtg
gtcatggtggtgctcatggcaatagcatttacattagcccaaccatggttccgacgtaac
aagctcaaggactccaatcccctcaaaaaaatgactggcttcaatgccttctggtttacc
caccacctgtttgtcattgtgtacactttgctctttgtccatggaacgtgcttgtatcta
agcaggaaatggtacaagaagacgacatggatgtacctcgctgttcctgttgtcctgtat
gtaagtgagcgtattcttcggttgtttaggagccatgatgcagttgggattcagaaggtt
gcagtgtatcccgggaatgtattggctctttatatgtcgaagccacctggtttcagatac
cgtagtgggcagtacatcttcataaaatgcactgctgtgtctccatatgaatggcatcca
ttttccataacatcagcacctggagatgattatcttagtgttcatattcgcacaaggggt
gattggacttcacggcttagaactgttttctctgaggcatgccgaccccccactgaggga
gaaagtggactacttagagctgacctttccaagggaataacggacgaaaaagcaagattc
ccaaaacttttggtcgatggaccgtatggtgcaccggcacaagattaccgtgaatacgat
gtgctacttctcatcgggctgggcatcggagccacccctttgattagcattgtgaaggac
gtgcttaaccacattcaaggtgagggatcagttggaaccacggagccggagagcagcagc
aaggcgaagaagaaacctttcatgacgaagagagcctacttctactgggtgacgagagag
gagggctcgtttgagtggttcagaggcgtcatgaacgaggtgtctgagaaggacaaggat
ggagtcattgagctccataaccactgctcaagcgtgtaccaggaaggcgatgctcgttct
gctctcattgtcatgctccaagaacttcagcatgcgaagaagggcgtcgatatcttgtcg
ggaactagtgtgaagacccatttcgcacgacctaattggcgaagcgtcttcaagaaggtt
gcggtcagccatgagaaccagcgcgtcggtgtgttctactgtggtgagcctgtgctggtt
ccccaactaaggcagttgtcagcagatttcacccacaagacaaacacaagatttgatttc
cacaaggagaacttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339397
Entry
4339397           CDS       T01015                                 
Name
(RefSeq) respiratory burst oxidase homolog protein A
  KO
K13447  respiratory burst oxidase [EC:1.6.3.- 1.11.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4339397
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4339397
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-
     4339397
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-
     4339397
SSDB
Motif
Pfam: NAD_binding_6 NADPH_Ox FAD_binding_8 Ferric_reduct EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 MPS2
Other DBs
NCBI-GeneID: 4339397
NCBI-ProteinID: XP_015639819
UniProt: A0A0P0WPQ4
LinkDB
Position
5:complement(26237492..26246103)
AA seq 951 aa
MRAGIGSGSGGGTTPVRPRWGSGVTTPRSLSTGSSPRGSDRSSDDGEELVEVTLDLQEDD
TIVLRSVEPAAGGAAVASSSGASPSAVAPPRRAEPPGGVASRSRSPAMRRTSSHRLLQFS
QELKAEAMARARQFSQDLTKRFTRTQSTTTAPPGIESALAARAERRQRAQLDRTKSGAQR
AIRGLRFISGPNKASNAWIEVQANFDRLARDGYLSRDDFPQCIGMTESKEFAMELFDTLS
RRRQMQVDKINKEELREIWQQITDNSFDSRLQIFFDMVDKNADGHITEAEVKEIIMLSAS
ANKLSRLKEQAEEYAALIMEELDPEQLGYIELWQLETLLLQKDTYVNYSQALSYTSQALS
QNLAGLRKRSPIRKISTKLSYYLEDNWKRLWVLALWIGIMAGLFIWKFIQYRHRYVFNVM
GYCVTTAKGAAETLKLNMAIILLPVCRNTITWLRNTRAARALPFDDNINFHKTIAAAIVV
GVILHGGLHLVCDFPRLIGSSEEKYAPLGKYFGETKPTYLTLVKGVEGITGVIMLVCMII
AFTLATRWFRRSLVKLPKPFDKLTGFNAFWYSHHLFIIVYISLVIHGEWLYLIRIWYKRT
TWMYLAVPVCLYVGERTLRFFRSGSYSVRLLKVAIYPGNVLTLQMSKPPTFRYKSGQYMF
VQCPAVSPFEWHPFSITSAPGDDYLSIHVRQLGDWTRELKRVFSAACEPPVGGKSGLLRA
DETTKKALPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLINSIIKMEEEE
EASGDLYPPIGRNKAHVDLDTLMRITSKPKRVLKTTNAYFYWVTREQGSFDWFKGVMNEI
AELDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDIVSGTKVRTHFARPNFK
KVLSKIASKHPYAKIGVFYCGAPVLAQELSDLCHDFNGRCTSKFEFHKEHF
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgagggcgggaatcggcagcggcagcggcggcggcactacgccggtgcggccgcgatgg
gggtctggtgtgacgacgccgcggtcgctgagcacggggtcgtcgccgcgcgggtcggac
cggagctccgacgacggggaggagctggtcgaggtgacgctcgacctgcaggaggacgac
accattgtgctgaggagcgtcgagccggcggcggggggagcggccgtggcgtcgtcgtcg
ggtgcgtcgccgtcagcggtggcgccgccgaggcgggcggagccgcctggcggggtggcg
tcgcggtcgaggtcgccggcgatgcggcggacgtcgtcgcaccggctgctgcagttctcg
caggagctcaaggccgaggccatggcccgcgcgcgccagttctcgcaggacctcaccaag
cgcttcacgcgcacccagagcaccaccaccgccccgccgggcatcgagtccgccctcgcg
gcccgcgcggagcgccggcagcgcgcgcagctcgaccgcaccaagtccggcgcgcagcgg
gcgatccgcggcctccgcttcatcagcggccccaacaaggccagcaacgcgtggatcgaa
gtccaggccaacttcgaccgcctcgcccgcgacggctacctctcccgcgacgatttcccg
caatgcatagggatgacggagtcgaaggagttcgccatggagctgttcgacaccttgagc
cggcggcggcagatgcaggtggacaagatcaacaaggaagaactgcgcgagatctggcag
cagatcaccgacaacagcttcgactcgcgcctccagatcttcttcgatatggtggataag
aacgcagatggccatattacggaggctgaggtgaaagagattattatgttaagtgcttct
gctaataaactgtcaagactcaaggagcaagcagaggaatatgcggccttgatcatggag
gaacttgatcccgaacagcttggctacattgagctctggcaattggagacattgctattg
caaaaagatacctatgtgaactatagccaagcattgagctacacaagccaggcactaagc
cagaaccttgctggtctaaggaaaaggagtccaatccggaaaataagcaccaaattaagc
tactatctggaggacaactggaagcgcctgtgggtacttgcactgtggattgggataatg
gctgggttgttcatttggaaattcatacaataccgccaccgatatgtctttaacgtgatg
ggctactgtgtaacaactgcaaaaggggctgctgagactcttaagctgaatatggctatt
atcctcctgccagtatgccgcaacaccatcacttggttgaggaatacaagggctgcacgg
gcattgccgttcgatgacaacatcaacttccacaagactattgcagcagcaattgtggtt
ggtgttatccttcatggagggctccatcttgtatgtgattttccacggctcataggttca
tcggaggagaagtatgctccactagggaagtattttggtgaaactaagccaacatatttg
accctggtcaaaggagtggagggcataactggggtaatcatgcttgtgtgcatgattatc
gcttttactcttgcaaccaggtggttccgccgtagcctggtgaagcttccaaagccattt
gacaaattaactggcttcaacgctttctggtattctcaccatctattcatcattgtgtac
atatcacttgtaattcatggagagtggctataccttatccgcatatggtacaaaaggacg
acatggatgtatcttgcagtgcccgtttgtttgtatgtaggggagaggacactgaggttc
ttcaggtctggcagttattctgtccgtctgttgaaggtggccatctatcctggtaatgtt
ttaacactgcagatgtctaagcctcccacattccgttataagagtgggcagtatatgttt
gttcaatgtccagctgtttcaccctttgaatggcatcccttctcaataacttcggcacct
ggggatgactatctcagcattcatgttcggcaacttggtgactggacaagagagctcaag
agggtgttctcagcggcttgtgagccaccagtgggtgggaaaagtggtctccttagagca
gatgagactaccaagaaagccttacccaaattgttgattgatggtccatatggctctcct
gcgcaagactacagcaagtatgatgttttactgctggttggattaggaattggcgcaacg
ccttttatcagcatattgaaagaccttatcaacagcatcatcaaaatggaggaagaggaa
gaagcttcaggtgatctttacccgccaatcggacgcaataaagcacatgttgatcttgac
acccttatgaggattacctcaaaaccaaagagggttttgaagacaacaaatgcttatttt
tattgggtgacacgtgaacaaggctcttttgattggtttaaaggagtcatgaatgagatt
gctgaactagatcaaaggaatattattgagatgcacaactacctcacaagtgtttacgag
gaaggggatgctcggtcagcactcattactatgctgcaagctctaaaccatgccaagaat
ggtgttgatatagtatctggaactaaagtccgtacacattttgcaaggccaaattttaag
aaggttctttctaagatagcctccaaacatccttatgctaaaataggagtattctactgt
ggggctccagttctggctcaggaattaagcgatctttgccatgattttaatggcagatgc
acgtcaaaatttgagtttcacaaggagcatttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345742
Entry
4345742           CDS       T01015                                 
Name
(RefSeq) respiratory burst oxidase homolog protein E
  KO
K13447  respiratory burst oxidase [EC:1.6.3.- 1.11.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4345742
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4345742
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-
     4345742
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-
     4345742
SSDB
Motif
Pfam: NAD_binding_6 NADPH_Ox FAD_binding_8 Ferric_reduct EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_1
Other DBs
NCBI-GeneID: 4345742
NCBI-ProteinID: XP_015650217
LinkDB
Position
8:22210492..22219986
AA seq 978 aa
MWTPSRGSASGRRATGHRRIADYLADDRTEASTENGSFNTAYSDELFAPTSSSAGGDGVG
GMLPAFLADQSDLVEVMLELDEESMVVRSVTPTTGALYGPTSLAGGGAAHTPPGSGRSLS
RCSSTSSRIRKKFAWLRSPSPAPAPRAPTPSEPPPPREAAMAARERRRIQARLNRSRSGA
RRALKGLRFISRTTGSAEAAELWTRVEHRFNALSRDGLLSRDNFGDCIGMEDSKEFAVGI
FDALARRRRQELERISKEELYDFWVQISDQSFDARLQIFFDMVDTNVDGRITREEVQELI
VLSASANKLSKLKEQAEEYASLIMEELDPEDLGYIELWQLEALLLQRDAYMNYSRPLSSG
STAQWSQNLGGGGGGQQGGQGQGQGQSEGRRNDWRRRWSPRRAAARAQVAAEENWRRAWV
LALWFAAMAGLFAWKFVQYRRTPAFRVMGYCLPTAKGAAETLKLNMALVLLPVCRNTLTW
LRSSWARFFVPFDDSITFHKIIATAIALGICTHAGTHLACDFPRLIGSSREEYELLLSGF
FGASRPTYRGLLAGVEGVTGIVMVVLMVVSFTLATRPLRKREAPRLPFPLGHLAGFNAFW
YSHHLLIVVYLLLLVHGWFMFLVTKWHQRTTWMYIAVPLMLYVGERTLRAFRSKAYAVKI
LKVCLLPGNVLTITMSKPYGFRYRSGQYIFLQCPTISPFEWHPFSITSAPGDDYISVHIQ
TRGDWTQELKRIFVENYFVPSVPRRASFGALGMAEQKSPPRLLVDGPYGAPAQDFRNYDV
LLLVGLGIGATPFISILRDLLNNIKLADELMDLAMETSRSDDSANSFSVSTASSNKRRAY
RTSRAHFYWVTREPGSFEWFKGVMNEVAEMDKKGVIELHNYLTSVYEERDARSTLLSMVQ
ALNHAKHGVDIVSGTRVRTHFARPNWKEVFTRIASKHPNSTVGVFYCGKPTLAKELKKLS
LDMSHKTTTRFHFHKEYF
NT seq 2937 nt   +upstreamnt  +downstreamnt
atgtggacgccgtcgcgggggtcggcgagcgggcggcgggcgacgggtcaccgccgcatc
gcggactacctcgccgacgaccggacggaggcgtcgacggagaacgggtcgttcaacacg
gcctacagcgacgagctgttcgcgccgacgtcgtcgtccgccggcggcgatggcgtcggt
ggaatgctgccggcgttcctcgccgaccagagcgacctcgtggaggtcatgctggagctc
gacgaggagtccatggtggtgcggagcgtgacgcccaccacgggcgcgctgtacgggccc
acgtcgttggccgggggcggcgccgcgcacacgccgccggggagcgggcggagcctgagc
cggtgctcgtcgacgtcgtcgcggatacgcaagaagttcgcgtggctacggtcgccgtcg
cccgcgccggcgcctcgcgcccccacgccgtcggagccgccgccgccgcgggaggcggcg
atggccgcacgcgagcggcggcgcatccaggcgcggctgaaccggtcccgctccggcgcc
aggcgcgccctcaagggcctccgcttcatcagccgcaccaccggctccgccgaggccgcc
gagctctggacccgcgtcgagcaccgcttcaacgccctctcccgcgacggcctcctctcc
cgcgacaacttcggcgactgcatcgggatggaggactcgaaggagttcgccgtgggcatc
ttcgacgcgctggcgcggcggcggcggcaggagctcgagcggatcagcaaggaggagctc
tacgacttctgggtccaaatctccgaccagagcttcgacgcgcgcctccaaatcttcttc
gacatggtggataccaacgtggacgggaggatcactagggaggaagtgcaggagctgatc
gtgctgagcgcgtcggcgaacaagctgtcgaagctgaaggagcaggcggaggagtacgcg
tcgctgatcatggaggagctcgacccggaggacctcggctacatcgagctgtggcagctg
gaggcgctgctgctccagcgagacgcgtacatgaactacagccggccgctcagcagcggc
agcacggcgcagtggagccagaacctcggcggcggcggcggagggcagcaaggagggcaa
gggcaggggcaggggcagtcggaggggaggaggaacgactggaggcggcggtggagcccg
cggcgagcggcggcgagggcgcaggtggcggcggaggagaactggcggcgcgcgtgggtg
ctggcgctgtggttcgccgccatggcgggactgttcgcgtggaagttcgtgcagtaccgc
cgcacgccggcgttccgggtgatggggtactgcctcccgacggcgaagggcgccgccgag
acgctcaagctcaacatggcgctcgtcctcctccccgtctgccgcaacacgctgacgtgg
ctccgctcctcctgggcccgcttcttcgtccccttcgacgacagcatcaccttccacaag
atcatcgcgacggcaatcgcgctgggcatctgcacgcacgcggggacgcacctggcgtgc
gacttcccgcggctgatcgggtcgagccgggaggagtacgagctgctgctgtccggcttc
ttcggcgcgtcgcggccgacgtaccggggcctcctcgccggcgtcgagggggtcaccggg
atcgtcatggtggtgctcatggtggtctccttcacgctggcgacgcggccgctgcggaag
cgggaggcgccgcgcctcccgttcccgctcggccacctcgccggcttcaacgccttctgg
tactcgcaccacctcctcatcgtcgtctacctccttctgctcgttcatggctggttcatg
ttcctcgtcaccaagtggcaccagaggacgacatggatgtacattgctgtgccattgatg
ctttatgtcggcgaaaggacgctacgggccttcagatccaaggcttatgcagtaaaaatc
ctgaaggtgtgtcttctaccgggtaatgtgttgaccatcacaatgtcaaagccttatgga
ttcagatacaggagtgggcagtacattttccttcagtgtccaacgatctctccatttgaa
tggcaccctttctccatcacttcagcacctggagatgactacatcagtgtccatatccag
accaggggggactggacgcaggagctcaagcgcattttcgtcgagaactatttcgtgcca
agcgttccgagaagagcttcatttggagctctaggcatggcagaacagaagagtccacca
aggttgcttgtagatggcccttatggcgcgccggcgcaggatttcaggaactacgatgtt
cttctccttgtcggcctcgggatcggtgcgacgcctttcataagcattcttagagatctg
ctgaacaacatcaagctggctgatgagctgatggatctggcaatggagactagcaggtct
gacgacagcgccaacagcttcagtgtgtcgacggcgagcagcaacaagaggagagcgtac
aggacgagcagggcacacttctactgggttacaagagagccagggtcattcgaatggttc
aagggggtgatgaatgaagttgctgaaatggacaagaagggtgtcatagagctgcacaac
tatctcacaagtgtgtatgaagagcgtgatgccaggtcgacgctgctctcaatggtgcag
gccctgaaccatgcaaagcatggtgtagatattgtgtcaggcacaagggtcaggacacat
tttgcaaggcctaactggaaggaggtcttcactagaattgcttccaagcaccccaattct
acagtaggggtattttactgtggaaagcccacactagccaaagaattgaagaaactatca
cttgacatgagccacaaaacgacaactcgcttccatttccacaaggagtacttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347158
Entry
4347158           CDS       T01015                                 
Name
(RefSeq) respiratory burst oxidase homolog protein E
  KO
K13447  respiratory burst oxidase [EC:1.6.3.- 1.11.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4347158
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4347158
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-
     4347158
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-
     4347158
SSDB
Motif
Pfam: NAD_binding_6 NADPH_Ox FAD_binding_8 Ferric_reduct EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6
Other DBs
NCBI-GeneID: 4347158
NCBI-ProteinID: XP_015612440
UniProt: A0A0P0XNE4
LinkDB
Position
9:16186269..16197221
AA seq 1007 aa
MWTPSRGSNAARRSGHRRIADYLADDQTTNTDTSDNESYTTAYGDEFFAAAAAAAGSGGG
GMLPAFLADQGDLVEVMLELDEESMVVRSVTPTSATLYGGGGGQMPQPLPPPLRTPEGGG
GARSLSRCSSTSSRIRKKFAWLRSPSPSPSPRPPTPAELQREAAMAARERRRIQARLNRS
STGAKRALKGLRFISRTTGTVQAAELWRRVEDRFNALARDGLLSRDDFGECIGMVDSKEF
AVGIFDALARRRRQNLERITREELYDFWLQISDQSFDARLQIFFDMVDTNVDGRITREEV
QELIVLSASANKLAKLKEQAEEYASLIMEELDPENLGYIELWQLEALLLQRDSYMNYSRP
LSTASGAQWSQNLGGAAVAAGAAAATGGGAHAAVAARGGQQQQQQQEGRRGGWGVRKAAA
RVRVAAEENWRRAWVVALWFAAMASLFVWKFVQYRRTPAFRVMGYCLPTAKGAAETLKLN
MALVLLPVCRNTLTWLRSSWARFFVPFDDNITFHKMIATAIVVGITLHAGNHLACDFPRL
IASGPEEYRLVADAFGPEKPTYVGLLSGVEGITGVAMVVLMTVSFTLATHPFRKGEKGGS
GGGAAATVLPTVARLPSPFNRLAGFNAFWYSHHLLGIVYALLIAHGYFLFLVRRWYLKTT
WMYISVPLMLYVGERMLRALRSNAYAVKILKVCLLPGNVLTITMSKPYGFRYRSGQYIFL
QCPTISPFEWHPFSITSAPGDDYLSVHIRTNGDWTQELKRIFVENYFSPHLNRRASFSEL
GATEPRSLPRLLVDGPYGAPAQDFRNYDVLLLVGLGIGATPFISILRDLLNNIKLAEELM
DLAMETSRSEDSANSFSVSTASSNKKRAYRTSRAHFYWVTREPLSFEWFKGVMNEVAEMD
KKGVIELHNYLTSVYEERDARTTLLSMVQALNHAKHGVDIVSGTRVRTHFARPNWKEVFT
RIASKHPNSTVGVFYCGAPTLAKELKTLSHEMSHRTGTRFHFHKEYF
NT seq 3024 nt   +upstreamnt  +downstreamnt
atgtggacgccgtcgcgcgggagcaacgccgcgcggcggagtggccataggcgcatcgcg
gactacctcgccgacgaccagaccaccaacaccgacacctccgacaacgagtcatacacc
accgcctatggcgatgagttcttcgccgcggcggcggcggcggccgggagtggagggggt
ggtatgctgccggcattcctcgccgaccagggggacctcgtcgaggtcatgctggagctc
gacgaggagtccatggtcgtgcgcagcgtcactcccaccagcgccactctctacggcggc
ggcggcgggcagatgccacagccgctgccgccgccgctgcgcacgccggaggggggcggg
ggagcgcggagcctgagccggtgctcgtcgacgtcgtcgcggatacggaagaagttcgcg
tggctgcgctcgccgtccccctcgccgtcgccgcgcccgccgacgcccgcggagctgcag
cgcgaggcggccatggcggcgcgcgagcgccgccgcatccaggcccgcctcaaccgctcc
agcaccggcgccaagcgcgccctcaagggcctccgcttcatcagccgcaccaccggcacc
gtccaggccgccgagctctggcgccgcgtcgaggaccgcttcaacgccctcgcccgcgac
ggcctcctctcccgcgacgacttcggcgaatgcatcggaatggtggactccaaggagttc
gccgtcggcatcttcgacgcgctggcgcggcggcggcgacagaatctggagcggatcacc
agagaggagctctacgacttctggctccagatctccgaccagagcttcgacgcgcgcctc
cagatcttcttcgacatggtggacaccaacgtggatgggaggataacgagggaggaagta
caggagctgatcgtcctgagcgcgtcggcgaacaagctggcgaagctgaaggagcaagcg
gaggagtacgcgtcgctcatcatggaggagctcgacccggagaacctcggctacattgag
ctgtggcagctggaggcgctgctgctccagcgcgacagctacatgaattacagccggccg
ctgagcacggcgagcggcgcccagtggagccagaacctcggcggcgccgccgtggcggcg
ggggcggcagcagcaacaggcggaggagcgcacgcggcggtggcggcgagaggggggcag
cagcagcagcagcagcaggaggggaggaggggagggtggggggtgaggaaggcggcggcg
agggtgagggtggcggcggaggagaactggcggcgggcgtgggtggtggcgctgtggttc
gccgccatggcgtcgctgttcgtgtggaagttcgtgcagtaccggcgcacgccggcgttc
cgggtgatggggtactgcctcccgacggcgaagggcgccgccgagacgctcaagctcaac
atggcgctcgtcctcctccccgtctgccgcaacacgctgacgtggctccgctcctcctgg
gcccgcttcttcgtccccttcgacgacaacatcaccttccacaagatgattgcgacggcg
atcgtggtggggatcacgctgcacgcggggaaccatctggcgtgcgatttcccgaggctg
atcgcgtcggggccggaggagtaccggctggtggcggacgcgttcgggccggagaagccg
acctacgtggggctcctctcgggcgtggagggcatcacgggggtcgccatggtggtgctc
atgaccgtctccttcacgctggccacccacccgttccgcaagggcgagaagggtggcagc
ggcggtggcgcagccgccaccgtcctccccacggtagcgcggctcccctcgccgttcaac
cgcctcgcggggttcaacgccttctggtactcccaccacctcctcggcatcgtctacgct
cttcttatcgcccatgggtacttcctcttcctcgtccgtcgctggtatttgaaaacgaca
tggatgtacatttctgttccattgatgctgtatgtcggtgaaaggatgctacgagccttg
cggtcaaatgcttatgctgtcaaaatcttgaaggtctgccttctacctggaaatgtattg
accataacaatgtcaaagccctacggatttcgatatagaagtggacagtacatatttctt
cagtgtcccacaatttctcccttcgaatggcatcccttctccatcacttcagctcctgga
gatgactacctcagtgttcacatccgaacaaacggagactggacacaggagctgaagcgc
atattcgtcgagaactacttctcgccacaccttaacagaagagcttcattcagcgagcta
ggcgccacagaaccaagaagcttaccaagattgctcgtcgacggtccctatggcgcccct
gcacaggatttcagaaactacgacgtgctgcttcttgtcggcctcgggatcggggcgaca
ccattcatcagcatcctgagggacctacttaacaatattaagctagctgaagagctgatg
gacttggcaatggagaccagtagatctgaggacagtgccaacagcttcagtgtgtcaaca
gcaagtagcaacaagaagagggcatacagaacaagccgcgcacatttttactgggttacc
cgggagccattgtcatttgagtggttcaaaggagtgatgaatgaggttgctgaaatggac
aagaagggtgtgatagagctgcacaattatctgacgagcgtttacgaggagcgcgatgcg
cggacaactctgctgtccatggtgcaagctctgaaccatgccaagcatggtgttgacatc
gtctcaggcacaagggtgaggacacattttgcaagaccaaactggaaagaagtcttcacc
aggattgcctccaagcaccccaattcaacagttggagttttctactgcggcgcgccgacg
ctagccaaggagctgaagaccctgtcccacgagatgagccacaggacggggactcgcttc
catttccacaaggagtacttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352439
Entry
4352439           CDS       T01015                                 
Name
(RefSeq) respiratory burst oxidase homolog protein B
  KO
K13447  respiratory burst oxidase [EC:1.6.3.- 1.11.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4352439
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4352439
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-
     4352439
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-
     4352439
SSDB
Motif
Pfam: NAD_binding_6 NADPH_Ox FAD_binding_8 Ferric_reduct EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 DUF5377
Other DBs
NCBI-GeneID: 4352439
NCBI-ProteinID: XP_015618608
UniProt: Q2QP56
LinkDB
Position
12:21648060..21653570
AA seq 909 aa
MASREESGNGGGGGATPAADYRSSDSRSSSRRSTRFKEDNEYVEITLDVKGDDTVAIQSI
RNGADMPEVALLARGLAQQPPPSAAPGPGGLSSRLKAVRTELRRIASWKFPSGVLSGGGG
GGDAPGNGNDRRPRLDRSMTGAARALRGLQFLNSSAVTNGWPEVEKRFERLAVDGFLLRS
RFGQCIGMVGSEEFAVQIFDSLARRRGITAQLLTKDQLREFWEQLSDPGFDAKLQTFFDM
VDKNADGQITEEELKEVLTLTASANKLSKILERVDEYTALIMEELDPDQLGYIDISNLES
LLLLPPSQAPSKLVTHSSNISQLISQKLVPTHDRNPLRRGLRRLSYFMEDNWKRVWVMAL
WLAINAGLFTWKFMAYKRHPTFDVMGYCVCVAKGGAETTKFNMALILLPVCRNTITWLRS
RTKLGAVIPFNDNINFHKVVAGGVVVGVALHGVTHLTCDFPRLLHASDAAYEPMKKYFGQ
TRIPDYWWFVRGVEGITGVIMVVLMAIAYTLAHPWFRRSKLSDSNPLKRLSGFNMFWYSH
HLFVIVYIAFVVHGVCLYINRTWWKQTTWMYLAIPILLYAGERIFRALRSHGFTTVRIEK
VAIYPGNVIAIHMTKPHGFKYKSGQYIYVNCGEVSPFEWHPFTITSAPDDSYLSMHIRCR
GDWTSSFRAIFSQICRPPMNGQSGLLRADCMSMEHHSRFPKLLIDGPYGAPAQDYWKYDV
LLLIGLGIGATPLISIVKDVLNHIYDDPESAASPHTTNGGGAAAAARRAFMTKRVYFYWC
TREEGSFEWFRGVMNEVADRDAGRELIELHNHCTSVYEEGDARSALVTMLQALHHAKNGV
DVVSGTRVRTHFARPSWRDVFKRVAVNHQGQRVGVFFCGDQALTPELRRLAQDFSHKTTT
KFVFHKENF
NT seq 2730 nt   +upstreamnt  +downstreamnt
atggcgagccgggaggagagcggcaatggcggtggcggtggcgcgacgccggcggcggat
taccggagctcggacagccggagctcgagccggcggagcacgcggttcaaggaggacaac
gagtacgtggagatcacgctcgacgtcaagggcgacgacacggtcgccatccagagcatc
cgcaacggcgccgacatgcccgaggtcgccctcctcgcgcgcggcctcgcgcagcagccg
ccgccgtccgcggcgcccggccccggcgggctctcgtcgcggctcaaggcggtgaggacc
gagctgaggcggatcgcgtcgtggaagttccccagcggcgttctcagcggcggcggcggc
ggcggcgacgcgccgggcaacggcaacgaccgccgccctcgcctcgaccggagcatgacc
ggcgccgcccgcgcgctgcgcgggctccagttcctcaactccagcgccgtcaccaatggc
tggccggaggtggagaagaggttcgagcgcctcgccgtcgacggcttcctcctccgctcc
cgcttcggccagtgcatcggaatggttggatccgaggagtttgcggttcagatcttcgac
tcgcttgcgcggcggcgagggatcacggctcagttgctgaccaaggatcagctccgggag
ttttgggagcagctctctgatccaggatttgatgccaagctgcagactttctttgacatg
gttgacaagaatgcagatggtcagatcactgaagaggagctcaaagaggtcctcaccctg
actgcctctgcaaacaagctgtccaagatcctggagcgcgtcgacgagtacaccgcgctg
atcatggaggagctcgatcccgatcaattaggctacatagatatatcaaacctggagtcg
ctgctgctgctgccgccgtcgcaggcgccgtcgaagctggtgacgcacagctccaacatc
agccagctgatcagccagaagctggtgccgacgcacgaccggaacccgctccggcggggg
ctccggcggctgtcctacttcatggaggacaactggaagcgggtgtgggtgatggcgctg
tggctggccatcaacgccggcctcttcacctggaagttcatggcgtacaagcgccacccg
acgttcgacgtcatgggctactgcgtctgcgtcgccaagggcggtgccgagaccaccaag
ttcaacatggccctcatcctcctccccgtttgccggaacaccatcacctggctccgttct
cgcaccaagctcggcgccgtcatccccttcaatgacaacatcaacttccacaaggtggtg
gcagggggagtggtggtaggggtggcgctgcacggggtgactcacctgacgtgcgacttc
ccgaggctgctgcacgcgagtgatgcggcgtacgagccgatgaagaagtacttcgggcag
acacggatcccggactactggtggttcgtgcgcggcgtagaggggatcaccggcgtgatc
atggtggtgctcatggccatcgcctacacgctggcgcacccgtggttccgccggagcaag
cttagtgacagcaacccgctgaagcggctcagcggtttcaatatgttttggtactcccac
cacctcttcgtcatcgtctacatcgccttcgttgtccatggcgtctgcctctacatcaac
cggacttggtggaagcagacgacatggatgtaccttgccatccctatcctgctctacgcc
ggtgagcggattttccgggctctgaggtctcatggcttcaccaccgtaaggattgagaag
gttgcaatctatcctggcaacgtgatagccatccacatgaccaagccccatgggttcaag
tacaagagtggccagtacatctatgttaactgcggcgaggtctcgccattcgagtggcac
ccgttcaccatcacctcggctcccgacgacagctatctcagcatgcatatccggtgccgc
ggtgactggacctcgagcttcagggccatcttctctcagatatgcaggcctccgatgaac
ggccagagcggcctcctccgggctgactgcatgtccatggagcaccattcaaggttcccc
aagctcctgatcgacgggccgtacggcgcgccggcgcaggactactggaagtacgacgtc
ctcctcctcatcggcctaggcatcggcgccacccctctcatcagcatcgtcaaggacgtc
ctcaaccacatctacgacgaccccgagtccgccgcctcgccgcacaccaccaatggcggc
ggcgccgcggccgcggcgaggagggcgttcatgacgaagcgcgtctacttctactggtgc
acgcgggaggagggctcgttcgagtggttccgcggcgtgatgaacgaggtggccgaccgc
gacgccgggcgcgagttgatcgagctccacaaccactgcaccagcgtgtacgaggagggg
gacgcgcggtcggcgctggtgacgatgctccaggcgctccaccacgccaagaacggcgtg
gacgtggtgtccgggacgcgggtgcgcacccacttcgcgcgcccgagctggcgcgacgtg
ttcaagcgcgtcgccgtgaaccaccaggggcagcgcgtcggcgtcttcttctgcggcgac
caggcgctcacgccggagctccgccgcctcgcccaggacttctcccacaagaccaccacc
aaattcgtcttccacaaggagaatttctag

DBGET integrated database retrieval system