KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278405
Entry
107278405         CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase V subunit 7
  KO
K16253  DNA-directed RNA polymerase IV and V subunit 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    107278405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    107278405
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     107278405
SSDB
Motif
Pfam: SHS2_Rpb7-N RNA_pol_Rbc25 Orbi_VP4
Other DBs
NCBI-GeneID: 107278405
NCBI-ProteinID: XP_015639452
LinkDB
Position
5:7662286..7662813
AA seq 175 aa
MVFLKVDMSWNVLISPSELSPKGLLLRKAVIVSLLEEIANRKASKDHGYYIAVSELKAIS
EGKVRELTGDVLFPVTFTCITQKPTKGEILVGSVDKILKHGVFLKSGPIESIFLSEKTLS
DYKYIGGENPMFMNDHSKLEKDTAVRFKVMGFRWMEADRQFQILATLAGDYLGPL
NT seq 528 nt   +upstreamnt  +downstreamnt
atggttttccttaaggtggatatgtcttggaatgtgttgatctcacctagcgagctgagc
cccaagggtctcttgctccgcaaggctgtcattgttagtcttctggaggagatagcaaac
aggaaggcctccaaggatcatggttactacattgctgtcagtgagctgaaggcgatatca
gaagggaaagtgcgcgagctgaccggagatgttcttttcccagtgacattcacctgcatc
acacagaagcctacgaagggcgagatcttagttggctctgtggataagatcctcaagcat
ggcgtgttcctcaaatctggaccaatagaaagcatcttcctgtcagagaagacactgagc
gactacaagtacatcggtggggagaaccctatgttcatgaatgaccactcgaagctggag
aaggacaccgctgtgcgcttcaaggtgatgggtttccgctggatggaagctgatcgccag
ttccagatccttgctaccctggctggtgactatcttgggccactatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337866
Entry
4337866           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase V subunit 7
  KO
K16253  DNA-directed RNA polymerase IV and V subunit 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4337866
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4337866
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     4337866
SSDB
Motif
Pfam: SHS2_Rpb7-N RNA_pol_Rbc25 S1_2
Other DBs
NCBI-GeneID: 4337866
NCBI-ProteinID: XP_015639920
UniProt: B9FHF5 Q75M02
LinkDB
Position
5:3362451..3362978
AA seq 175 aa
MVFLKVEMSLNVLISPSQLSPQGLLLRKAVIVRLLEDIANRKASKDHGYYIAVSELKAIS
EGKVRELTGDVLFPVTFTCITQKPMKGEVLVGSVDKILKHGIFLKSGPIESIFLSEKTMS
DFKYIGGENAVFMNEHSKLEKDTVVRFKVMGFRWMEADRQFQLLATLAGDYLGPL
NT seq 528 nt   +upstreamnt  +downstreamnt
atggttttccttaaggtggagatgtctttgaatgtgttgatctcacctagccagctgagc
ccccagggtctcttgctccgcaaggctgtcattgtccgccttctggaggatatagcaaac
cggaaggcctccaaggatcatggttactacattgctgtgagtgagctgaaggcgatatca
gaagggaaagtgcgtgagctgaccggagacgttcttttcccggtgacgttcacctgcatc
acgcagaagcctatgaagggcgaggtcttagttggctccgtggacaagatcctcaagcat
ggcattttcctcaaatctggaccgatagaaagcatctttctgtcggagaagacgatgagc
gacttcaagtacattggtggggagaacgcggtgttcatgaatgaacactcgaagctggag
aaggacaccgtcgtgcgcttcaaggtcatggggttccgctggatggaagccgatcgccag
ttccagctccttgctaccctggctggtgactatcttggaccactatga

DBGET integrated database retrieval system