KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278688
Entry
107278688         CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate oxidase 1-like
  KO
K05933  aminocyclopropanecarboxylate oxidase [EC:1.14.17.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107278688
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.4  aminocyclopropanecarboxylate oxidase
     107278688
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 107278688
NCBI-ProteinID: XP_015643347
UniProt: Q5Z7K8
LinkDB
Position
6:complement(22255905..22259194)
AA seq 293 aa
MEIPVIKMDELHGEKRSETLQLLHDACAQWGFFWLENHGINEDLMYKIKGLVNKHYEQSM
EKNFYNSETAKNLGPDNVVSNVDWECSFMYRHQPESNIHDIPELVRTTLPEYAEEVIKLA
ERLAEVMSENLGLDKDYLKKAFSNPSVGIKAAKYPRCSHPEFVMGLRGHTDAGGIILLLQ
DDLVPGLEFLKDGRWMPIPPTQGNQIFVNLGDQVEVISNGIYKSICHQVVPNKNGSRLSI
ATFYNPGPDAIVFPAQKLTYPSQYRFKDYLEFYSTTKFTDKVSRFQTTKMIFK
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaaatcccagtgataaagatggatgagctgcatggagagaagaggtcagagacactt
cagctactccatgatgcctgtgctcaatggggtttcttttggcttgagaaccatgggatc
aacgaggatctcatgtacaaaatcaagggattggtgaacaaacactatgagcaaagcatg
gagaagaacttctacaattctgagacggcaaagaacctaggtcctgataatgttgtctca
aatgttgactgggagtgcagttttatgtatcgtcaccagccagaatcgaacattcatgat
attcctgagctggtccgtaccactcttcctgaatatgctgaagaagtaatcaagttggca
gagcggctagcagaagttatgagtgagaaccttgggcttgacaaggattacttgaagaaa
gcgttttctaatccttccgtaggcataaaggcggccaagtaccctaggtgcagtcatccc
gaatttgtgatggggctccgcggacacactgacgctgggggaatcatacttctactccaa
gatgacttggtccctggtttggagttcttgaaagatggtagatggatgccaataccacca
acacaaggcaatcaaattttcgtaaaccttggagatcaggttgaagtgataagcaatgga
atatataagagcatttgccatcaggtagtacccaataagaacgggagccgcctatctatc
gcaacattctacaacccaggtcctgatgctatagtcttcccagctcaaaagcttacgtat
cctagtcaataccgtttcaaagactacctcgaattttactccactacgaagttcactgac
aaagtatcaaggttccaaactacaaagatgatatttaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324194
Entry
4324194           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate oxidase 1
  KO
K05933  aminocyclopropanecarboxylate oxidase [EC:1.14.17.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4324194
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.4  aminocyclopropanecarboxylate oxidase
     4324194
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4324194
NCBI-ProteinID: XP_015632196
UniProt: B7ET75 Q0JLQ6
LinkDB
Position
1:22489377..22491219
AA seq 312 aa
MEIPVIDLKGLAGGDEERERTMAQLHEACKDWGFFWVENHGVEAALMEEVKSFVYRHYDE
HLEKKFYASDLAKNLHLNKDDGDVLVDGGDLADQADWEATYFIQHRPKNTAADFPDIPPA
ARESLDAYIAQAVSLAELLAGCISTNLGLAGAAGVVDAFAPPFVGTKFAMYPPCPRPDLV
WGLRAHTDAGGIILLLQDDAVGGLEFHRGGREWVPVGPTRRGRLFVNIGDQVEVLSGGAY
KSVVHRVAAGAEGRRLSVATFYNPGPDAVIAPATAAAPYPGPYRYGDYLDYYQGTKFGDK
TARFQAVKKLFS
NT seq 939 nt   +upstreamnt  +downstreamnt
atggagattccagtgattgatctcaaggggctcgccggcggcgacgaagaaagggagcgc
accatggcccagctccacgaggcctgtaaggactggggcttcttctgggtggaaaaccat
ggcgtggaggcggcgttaatggaggaggtgaagagcttcgtgtaccgccattacgacgag
cacctggagaagaaattctacgcctccgacctcgccaagaacctccacctgaacaaggac
gacggcgacgtcctcgtcgacggcggcgacctcgccgaccaggccgactgggaggccacc
tacttcatccagcaccgccccaagaacaccgccgccgacttcccggacatcccgccggcg
gcgagggagtccctggacgcgtacatcgcgcaggcggtgtccctcgccgagctgctcgcc
ggctgcatcagcaccaacctgggcctcgccggcgccgccggcgtcgtggacgccttcgcg
ccgccgttcgtcggcaccaagttcgccatgtacccaccgtgcccgcgcccggacctcgtc
tggggcctccgcgcccacaccgacgccggcggcatcatcctgctcctccaggacgacgcc
gtcggcgggctcgagttccaccgcggcggccgcgagtgggtccccgtcggcccgacccgg
cgcggccggctgttcgtcaacatcggcgaccaggtggaggtgctcagcggcggcgcctac
aagagcgtcgtgcaccgcgtcgccgccggcgccgagggccgccgcctgtccgtcgccacg
ttctacaaccccgggcccgacgccgtgatcgcgccggcgacggcggcggcgccgtacccc
gggccgtacaggtacggcgactacctggactactaccagggcaccaagttcggcgacaag
accgctaggttccaggccgtcaagaagctcttcagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330873
Entry
4330873           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate oxidase 1-like isoform X1
  KO
K05933  aminocyclopropanecarboxylate oxidase [EC:1.14.17.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4330873
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.4  aminocyclopropanecarboxylate oxidase
     4330873
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4330873
NCBI-ProteinID: XP_015625927
LinkDB
Position
2:32558619..32562652
AA seq 344 aa
MAGGLTSPPIRRSSPRWSLESDNVDQIDTTRRLRQMWIEAAFVGPPLRTGRGGRRRAATA
QMLNHGIAHELMDEVERVSKAHYANCREEKFKEFARRMLEAGEKGADVKGIDWESTFFVR
HRPVSNLADLPDVDDHYRQVMKQFASEIEKLSERVLDLLCENLGLEKGYLKKAFAGSNGP
TFGTKVSSYPPCPRPDLVDGLRAHTDAGGIILLFQDDQVSGLQLLKDGEWVDVPPMRHAI
VANIGDQLEVITNGRYKSVMHRVLTRPDGNRMSIASFYNPGADAVIFPAPALAAADAAAA
AYPRFVFEDYMNLYVRHKFEAKEPRFEAMKSAAEVVHAAPIATA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggctggcggcctcacctctccccccatccggcggtcctctcctcggtggagcctcgaa
tcggacaacgtcgaccagatcgacacgacaaggaggttgaggcagatgtggatcgaggcg
gccttcgtcgggccaccactgcggacgggtcgaggtggccgtcgtcgagctgctactgca
cagatgctgaaccatggcatcgcgcacgagctgatggacgaggtggagcgggtgagcaag
gcgcactacgccaactgccgggaggagaagttcaaggagttcgcgcggcggatgctggag
gccggcgagaagggcgccgacgtgaagggcatcgactgggagagcaccttcttcgtccgc
caccgccccgtctccaacctcgccgacctccccgacgtcgacgaccactacaggcaggtg
atgaagcaatttgcgtcggagatcgagaagctctcggagagggtgctggacctgctgtgc
gagaatctgggcctggagaagggttacctgaagaaggccttcgccgggtcgaacggccca
acgttcggcaccaaggtgagcagctacccgccgtgcccgcgccccgatctcgtcgacggc
ctccgcgcccacaccgacgccggtggcatcatcctgctgttccaggacgaccaggtgagc
ggcctccagctgctcaaggacggggagtgggtggacgtgccgcccatgcgccacgccatc
gtcgccaacatcggcgaccagctggaggtgatcaccaacggcaggtacaagagcgtcatg
caccgcgtcctcacgcgccccgacggcaaccgcatgtccatcgcctccttctacaacccc
ggcgccgacgccgtcatcttcccggcgcccgcgctcgccgccgccgacgcggcggcggcc
gcctacccgaggttcgtgttcgaggactacatgaacctgtacgtgcgccacaagttcgag
gccaaggagccacgcttcgaggccatgaagtccgccgccgaggtcgtccacgcggcgccc
atcgccaccgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337818
Entry
4337818           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate oxidase
  KO
K05933  aminocyclopropanecarboxylate oxidase [EC:1.14.17.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4337818
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.4  aminocyclopropanecarboxylate oxidase
     4337818
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4337818
NCBI-ProteinID: XP_015640814
UniProt: A0A0P0WHY8 Q65XE5
LinkDB
Position
5:2825305..2826914
AA seq 308 aa
MVVPVIDFSKLDGTAAERAETMAQIDNGCEEWGFFQLVNHGVPKELLDRVKKVCLESYRL
REAAFMESEPVRTLEGLMAAERRGEAAAPVDDMDWEDIFYLHDDNQWPSNPPEFKETMRE
YRAALRGLAERVMEAMDENLGLDKGRMRRAFTGDGRHAPFFGTKVSHYPPCPRPDLITGL
RAHTDAGGVILLFQDDRVGGLQVLRGGEWVDVQPLADAIVVNTGDQVEVLSNGRYRSAWH
RVLPMRDGNRRSVASFYNPAFEATISPAVGAGGEYPEYVFGEYMDVYAKQKFDAKEPRFE
AVKAPKSA
NT seq 927 nt   +upstreamnt  +downstreamnt
atggttgttccggtgatcgacttctccaagctcgacggcaccgccgcagagagggctgag
acgatggcgcagatcgacaatggctgcgaggagtggggattcttccagctggtgaaccat
ggcgtcccgaaggagcttcttgatcgggtgaagaaggtgtgcttggagagctaccgactc
cgggaggcggcgttcatggagtcggagccggtgaggacgctggaggggctcatggcggcg
gagcggcgcggcgaggcggcggcgccggtggacgacatggactgggaggacatcttctac
ctccacgacgacaaccagtggccgtcgaacccgccggagttcaaggagacgatgcgcgag
taccgcgcggcgctgcgggggctcgccgagagggtgatggaggccatggacgagaacctc
ggcctcgacaaggggcgcatgaggcgcgccttcaccggcgacggccgccacgcgccgttc
ttcggcaccaaggtcagccactacccgccgtgcccgcgccccgacctcatcaccggcctc
cgcgcccacaccgacgccggcggcgtcatcctgctgttccaggacgaccgcgtcggcggc
ctccaggtgctcaggggcggcgagtgggtcgacgtgcagccgctcgccgacgccatcgtc
gtcaacaccggcgaccaggtggaggtgctcagcaacggccgctaccgcagcgcgtggcac
cgcgtcctccccatgcgcgacggaaaccggcgctccgtcgcgtcgttctacaacccggcg
ttcgaggccaccatctcgccggcggtgggcgccggcggcgagtacccggagtacgtgttc
ggcgagtacatggatgtgtacgccaagcagaagttcgatgcgaaggagccacgcttcgag
gccgtcaaggcgccaaaatctgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347224
Entry
4347224           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate oxidase 1
  KO
K05933  aminocyclopropanecarboxylate oxidase [EC:1.14.17.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4347224
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.4  aminocyclopropanecarboxylate oxidase
     4347224
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4347224
NCBI-ProteinID: XP_015651336
UniProt: Q67UG1 A0A0P0XMI8
LinkDB
Position
9:complement(16886123..16887629)
AA seq 322 aa
MAAALSFPIIDMSLLDGAERPAAMGLLRDACESWGFFEILNHGISTELMDEVEKMTKDHY
KRVREQRFLEFASKTLKEGCDDVNKAEKLDWESTFFVRHLPESNIADIPDLDDDYRRLMK
RFAAELETLAERLLDLLCENLGLEKGYLTKAFRGPAGAPTFGTKVSSYPPCPRPDLVKGL
RAHTDAGGIILLFQDDRVGGLQLLKDGEWVDVPPMRHSIVVNLGDQLEVITNGRYKSVMH
RVVAQIDGNRMSIASFYNPGSDAVISPAPALVKEEEAGETYPKFVFEDYMKLYVRHKFEA
KEPRFEAFKAMENETPNRIAIA
NT seq 969 nt   +upstreamnt  +downstreamnt
atggcggcagcattgtcgttcccgatcatcgacatgagtctgctcgacggggcagagagg
cccgcggcgatggggctgctccgcgacgcatgcgagagctggggcttctttgagatcctg
aaccacggcatctcgacggagctgatggacgaggtggagaagatgaccaaggaccactac
aagcgtgtgcgcgagcagaggttcctcgagttcgcgagcaagacgctcaaggaaggctgc
gacgacgtgaataaggcggagaagctggactgggagagcaccttcttcgtccgccacctc
ccggagtccaacatcgccgacatacccgacctcgacgacgactacaggcgcctcatgaag
cgcttcgcggcggagctggagacgctggcggagcggctactggacctgctctgcgagaac
ctcggcctcgagaagggctacctcaccaaggccttccgtggccccgcgggcgcacccacc
ttcggcaccaaggtcagcagctacccgccgtgcccgcgccccgacctcgtcaagggcctc
cgcgcccacaccgacgccggcggcatcatcctgctcttccaggacgaccgcgtcggtggc
ctccagctgctcaaggacggcgagtgggtggacgtgccgcccatgcgccactccatcgtc
gtcaacctcggcgaccagctggaggtgatcaccaacggcaggtacaagagcgtgatgcac
cgggtggtggcgcagatcgacggcaacaggatgtccatcgcgtccttctacaaccctggc
agcgacgccgtcatctccccggcgccggcgctggtgaaggaggaggaggccggcgagacg
tatcccaagttcgtgttcgaggactacatgaagctgtacgtgcgccacaagttcgaggcc
aaggagccccggttcgaggcgttcaaggccatggagaacgagacccccaaccgcattgcc
atcgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347225
Entry
4347225           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate oxidase 1
  KO
K05933  aminocyclopropanecarboxylate oxidase [EC:1.14.17.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4347225
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.4  aminocyclopropanecarboxylate oxidase
     4347225
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4347225
NCBI-ProteinID: XP_015611803
UniProt: Q0J1C1
LinkDB
Position
9:16925444..16927006
AA seq 322 aa
MAPTSTFPVINMELLAGEERPAAMEQLDDACENWGFFEILNHGISTELMDEVEKMTKDHY
KRVREQRFLEFASKTLKEGCDDVNKAEKLDWESTFFVRHLPESNIADIPDLDDDYRRLMK
RFAAELETLAERLLDLLCENLGLEKGYLTKAFRGPAGAPTFGTKVSSYPPCPRPDLVEGL
RAHTDAGGIILLFQDDRVGGLQLLKDGEWVDVPPMRHSIVVNLGDQLEVITNGRYKSVIH
RVVAQTDGNRMSIASFYNPGSDAVISPAPALVKEEEAVVAYPKFVFEDYMKLYVRHKFEA
KEPRFEAFKSMETETSNRIAIA
NT seq 969 nt   +upstreamnt  +downstreamnt
atggcaccgacttcgacgttcccggtcatcaacatggagttgctcgccggggaggagcga
cctgcggcgatggagcagctggatgatgcttgcgagaactggggattcttcgagatcctg
aaccacggcatctcgacggagctgatggacgaggtggagaagatgaccaaggaccactac
aagcgtgtgcgcgagcagaggttcctcgagttcgcgagcaagacgctcaaggaaggctgc
gacgacgtgaataaggcggagaagctggactgggagagcaccttcttcgtccgccacctc
ccggagtccaacatcgccgacatacccgacctcgacgacgactacaggcgcctcatgaag
cgcttcgcggcggagctggagacgctggcggagcggctactggacctgctctgcgagaac
ctcggcctcgagaagggctacctcaccaaggccttccgtggccccgcgggcgcacccacc
ttcggcaccaaggtcagcagctacccgccgtgcccgcgccccgacctcgtcgagggcctc
cgcgcccacaccgacgccggcggcatcatcctgctcttccaggacgaccgcgtcggtggc
ctccagctgctcaaggacggcgagtgggtggacgtgccgcccatgcgccactccatcgtc
gtcaacctcggcgaccagctggaggtgatcaccaacggcaggtacaagagcgtgatccac
cgggtggtggcgcagaccgacggcaacaggatgtccatcgcgtcgttctacaaccctggc
agcgacgccgtgatctcccctgcgccggcgctggtgaaggaggaggaggccgtcgtggcg
taccccaagttcgtgttcgaggactacatgaagctgtacgtgcgccacaagttcgaggcc
aaggagcccaggttcgaggcgttcaagtccatggaaaccgagacctccaaccgcatcgcc
atcgcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349970
Entry
4349970           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate oxidase
  KO
K05933  aminocyclopropanecarboxylate oxidase [EC:1.14.17.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4349970
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.4  aminocyclopropanecarboxylate oxidase
     4349970
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4349970
NCBI-ProteinID: XP_015618010
UniProt: A3C9C8 Q53P53
LinkDB
Position
11:complement(4415925..4418648)
AA seq 309 aa
MAIPVIDFSKLDGDESEATLAELAAGFEEWGFFQLVNTGIPDDLLERVKKVCSDIYKLRE
DGFKESNPAVKALARLVDQEGEGLAMKKIEDMDWEDVFTLQDDLPWPSNPPSFKETMMEY
RRELKKLAEKLLGVMEELLGLEEGHIRKAFTNDGDFEPFYGTKVSHYPPCPRPELVDGLR
AHTDAGGLILLFQDDRFGGLQMIPNRGGDGRWIDVQPVENAIVVNTGDQIEVLSNGRFKS
AWHRILATRDGNRRSIASFYNPARMANIAPAIPAAAADYPSFKFGDYMEVYVKQKFQAKE
PRFAALANK
NT seq 930 nt   +upstreamnt  +downstreamnt
atggcgatcccggtcatcgacttctccaagctcgacggcgatgagagcgaggccaccctg
gcggagctcgctgcggggtttgaggagtgggggttcttccagctggtgaacactggcatc
cctgatgatctgctggaaagggtgaagaaggtgtgcagtgacatctacaagctgcgcgag
gatgggttcaaagaatccaaccccgcagtgaaggctctcgcccgcctggtagaccaggaa
ggcgagggcctcgcaatgaagaaaatcgaggacatggactgggaggacgtcttcaccctc
caggacgacctgccctggccctccaaccctccatccttcaaggagacgatgatggagtac
aggagggagctgaagaagctggcagagaagctgctgggagtgatggaggagcttcttggt
ctggaggaagggcacatcaggaaggccttcaccaacgacggcgacttcgagcccttctac
ggcaccaaggtgagccactacccgccgtgcccgcggccggagctcgtcgacggcctccgc
gcccacaccgacgccggcggcctcatcctcctcttccaggacgaccgcttcggcggcctc
cagatgatccccaaccgcggcggcgacggccggtggatcgacgtccagcccgtcgagaac
gccatcgtcgtcaacaccggggaccagatcgaggtgcttagcaatggccgcttcaagagc
gcatggcacagaatcctggccacccgggacggcaatcgccggagcatcgcctccttctac
aacccggcgcgcatggccaacattgctccggcgatccccgccgccgccgccgactacccg
agcttcaagttcggcgactacatggaggtgtacgtgaagcagaagttccaggccaaggag
cccaggttcgcagccctggcgaacaagtga

DBGET integrated database retrieval system