KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107279124
Entry
107279124         CDS       T01015                                 
Name
(RefSeq) ATP synthase subunit alpha, chloroplastic-like
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107279124
   00195 Photosynthesis
    107279124
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    107279124
Enzymes [BR:osa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     107279124
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     107279124
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   107279124
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N PD-C2-AF1 DUF4404
Other DBs
NCBI-GeneID: 107279124
NCBI-ProteinID: XP_015613749
UniProt: Q8S7T5 Q7G218
LinkDB
Position
10:complement(20477833..20485170)
AA seq 503 aa
MATLRVDEIHKILRERIEQYNRKVGIENIGRVVQVGDGIARIIGLGEIMSGELVEFAEGT
RGIALNLESKNVGIVLMGDGLMIQEGSFVKATGRIAQIPVSEAYLGRVINALAKPIDGRG
EIVASESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVA
TDTILNQKGQDVICVYVAIGQRASSVAQVVTTFHEEGAMEYTIVVAEMADSPATLQYLAP
YTGAALAEYFMYRERHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE
RAAKLNSLLGEGSMTALPIVETQSGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINV
GISVSRVGSAAQIKAMKQVAGKSKLELAQFAELQAFAQFASALDKTSQNQLARGRRLREL
LKQSQANPLPVEEQIATIYIGTRGYLDSLEIGQVKKFLDELRKHLKDTKPQFEEIISSSK
TFTEEAEILLKEAIQEQLERFSL
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcaacccttcgagtcgacgaaattcataaaattctccgcgaacgtattgaacaatat
aatagaaaagtagggattgagaatatcggtcgcgtagttcaagtgggggatgggattgct
cgtattataggtcttggtgaaataatgtcaggcgaattagtcgaatttgcagaagggact
aggggtattgctctgaatttggaatccaaaaatgttgggattgtattaatgggcgatggg
ttgatgatacaagagggcagttttgtaaaagcaacaggaagaattgctcagatacccgtg
agcgaggcttacttgggtcgtgttataaatgctctggctaaacctattgatgggagaggc
gaaattgtagcttcggaatctcgcttaattgaatctcctgctccgggtataatttccagg
cgttctgtatatgaaccccttcaaacggggcttattgctatcgattcgatgattcctatt
gggcgcggtcagcgagagttaattattggggacagacaaaccggcaaaacagcagtagct
acagatacaattctcaatcaaaaagggcaagatgtaatatgtgtttatgtagctatcggt
caaagagcatcctccgtagctcaagtagtaactactttccatgaagagggggccatggaa
tacactattgtagtagctgaaatggcggattcccctgctacattacaatacctcgctcct
tatacgggagcagccctggctgagtattttatgtaccgcgaacggcatactttaataatt
tatgatgatctctccaaacaggcacaagcttatcgccaaatgtcccttctattaagaaga
ccccccggccgcgaagcttacccaggggatgttttttatttgcattcacgccttttagaa
agagccgctaaattaaattctcttttaggggaaggaagtatgactgctttaccaatagtt
gagactcaatctggagacgtttccgcctatattcctactaatgtaatctccattacagat
ggacaaatattcttatccgcagatctattcaatgccggaattcggcctgctattaatgtg
ggtatttccgtttccagagtaggatccgcggctcaaattaaagccatgaaacaagtagct
ggcaaatcaaaattggaattagctcaattcgcggagttacaagcctttgcacaattcgcc
tctgctctcgataaaacaagtcagaatcaattggcaaggggccgacgattacgagaattg
cttaaacaatcccaagcaaatcctcttccagtggaagagcagatagctactatttatatc
ggaacaagaggatatcttgattccttagaaattggacaggtaaagaaatttctggatgag
ttacgtaaacacctaaaagatactaaacctcaattcgaagaaattatatcttctagcaag
acattcaccgaggaagcggaaatccttttgaaggaagctattcaggaacaactcgaacgg
ttttccctttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131390
Entry
3131390           CDS       T01015                                 
Symbol
atpA, OrsajCp022
Name
(RefSeq) ATP synthase CF1 alpha subunit
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    3131390 (atpA)
   00195 Photosynthesis
    3131390 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    3131390 (atpA)
Enzymes [BR:osa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     3131390 (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     3131390 (atpA)
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   3131390 (atpA)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N PD-C2-AF1
Other DBs
NCBI-GeneID: 3131390
NCBI-ProteinID: NP_039380
UniProt: P0C2Z6 Q7DNB0 A0A0K0LR50
LinkDB
Position
Pltd:34210..35733
AA seq 507 aa
MATLRVDEIHKILRERIEQYNRKVGIENIGRVVQVGDGIARIIGLGEIMSGELVEFAEGT
RGIALNLESKNVGIVLMGDGLMIQEGSFVKATGRIAQIPVSEAYLGRVINALAKPIDGRG
EIVASESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVA
TDTILNQKGQDVICVYVAIGQRASSVAQVVTTFHEEGAMEYTIVVAEMADSPATLQYLAP
YTGAALAEYFMYRERHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE
RAAKLNSLLGEGSMTALPIVETQSGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINV
GISVSRVGSAAQIKAMKQVAGKSKLELAQFAELQAFAQFASALDKTSQNQLARGRRLREL
LKQSQANPLPVEEQIATIYIGTRGYLDSLEIGQVKKFLDELRKHLKDTKPQFQEIISSSK
TFTEEAEILLKEAIQEQLERFSLQEQT
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcaacccttcgagtcgacgaaattcataaaattctccgcgaacgtattgaacaatat
aatagaaaagtagggattgagaatatcggtcgcgtagttcaagtgggggatgggattgct
cgtattataggtcttggtgaaataatgtcaggcgaattagtcgaatttgcagaagggact
aggggtattgctctgaatttggaatccaaaaatgttgggattgtattaatgggcgatggg
ttgatgatacaagagggcagttttgtaaaagcaacaggaagaattgctcagatacccgtg
agcgaggcttacttgggtcgtgttataaatgctctggctaaacctattgatgggagaggc
gaaattgtagcttcggaatctcgcttaattgaatctcctgctccgggtataatttccagg
cgttctgtatatgaaccccttcaaacggggcttattgctatcgattcgatgattcctatt
gggcgcggtcagcgagagttaattattggggacagacaaaccggcaaaacagcagtagct
acagatacaattctcaatcaaaaagggcaagatgtaatatgtgtttatgtagctatcggt
caaagagcatcctccgtagctcaagtagtaactactttccatgaagagggggccatggaa
tacactattgtagtagctgaaatggcggattcccctgctacattacaatacctcgctcct
tatacgggagcagccctggctgagtattttatgtaccgcgaacggcatactttaataatt
tatgatgatctctccaaacaggcacaagcttatcgccaaatgtcccttctattaagaaga
ccccccggccgcgaagcttacccaggggatgttttttatttgcattcacgccttttagaa
agagccgctaaattaaattctcttttaggggaaggaagtatgactgctttaccaatagtt
gagactcaatctggagacgtttccgcctatattcctactaatgtaatctccattacagat
ggacaaatattcttatccgcagatctattcaatgccggaattcggcctgctattaatgtg
ggtatttccgtttccagagtaggatccgcggctcaaattaaagccatgaaacaagtagct
ggcaaatcaaaattggaattagctcaattcgcggagttacaagcctttgcacaattcgcc
tctgctctcgataaaacaagtcagaatcaattggcaaggggccgacgattacgagaattg
cttaaacaatcccaagcaaatcctcttccagtggaagagcagatagctactatttatatc
ggaacaagaggatatcttgattccttagaaattggacaggtaaagaaatttctggatgag
ttacgtaaacacctaaaagatactaaacctcaattccaagaaattatatcttctagcaag
acattcaccgaggaagcggaaatccttttgaaggaagctattcaggaacaactcgaacgg
ttttcccttcaggaacaaacataa

DBGET integrated database retrieval system