KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107279348
Entry
107279348         CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit D-like isoform X1
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107279348
   03420 Nucleotide excision repair
    107279348
   03430 Mismatch repair
    107279348
   03440 Homologous recombination
    107279348
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    107279348
   03032 DNA replication proteins [BR:osa03032]
    107279348
   03400 DNA repair and recombination proteins [BR:osa03400]
    107279348
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    107279348
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    107279348
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     107279348
   MMR (mismatch excision repair)
     107279348
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     107279348
SSDB
Motif
Pfam: REPA_OB_2 Rep_fac-A_C DUF223 CIAPIN1 GP70 Peptidase_S37
Other DBs
NCBI-GeneID: 107279348
NCBI-ProteinID: XP_015616160
LinkDB
Position
1:42391689..42395166
AA seq 614 aa
MYRGAIEVLKPLIHEGKIYYIESFTVKDANRTYRPVSNDFMILFSKWTTLEECIDIPADF
PTITFSLTHFQEIPSLVGKNIFYVDIMGVITEISSTSIVRPRSRDADSLKRTLQICDASN
STLPVTLWGDRSTAFDAEKIYKDGQTKPQVVVFVGTLVRDYAGIGLTITGSSPCKWYINL
DIPDVLKLKESFSVNFQPIKWVENAAPAFNQDTPEEKTIKEILKLNPHKYKRARFIVNVT
IKSIHDENCWWYNSCDRCCRTSKPYGSTYRCSSCCYIGMPVPRYKVVLTTADNTSEAAFV
LFGRIAHRLIHRPVESLIEENPPDFIPAEIQALVDQAFVWNVSFTEHTVKRNQESLQVNS
IVSSGAPKQHFLPISPSASGRTSTIVPLSPGTSLQTPPAASESSIESQSSTRGKQSASLQ
PSLSTPTKYVVSAAADDTPTSKSNPSGSTKKKYVVLAYPMQSQTMQPSIDDKVSIPPVIL
IFSLFSALPYKQSNLLLNFARPQSQRVDRKLWNIHLFLQLDHLNLNLNIRSKELLSIHLM
IHLLALLCLAKVQAKKGTYGLLAYSASVIDAYNIGNLTDCYNLILHRTNTIASVPAPPAK
KLFKEHSQHTKDQR
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgtatcgaggcgcaattgaagttctgaaacctctcatccatgaagggaagatctactac
attgagtcgttcactgtcaaagatgcaaacaggacttatagaccagtttcaaatgacttc
atgattttattcagtaaatggacaaccttagaagaatgcattgacatcccagctgatttc
cctaccataacattttcattgacacatttccaagaaatcccctctcttgttggtaaaaac
atattctatgttgatattatgggcgtcattactgagatcagttccacatctatcgtgcgt
ccaaggtcaagggatgctgatagtttaaaaagaacattgcagatctgtgatgcaagcaac
tcaacactgcctgtcacactgtggggagatcgatcaactgcttttgatgcagagaaaata
tataaggatggccaaactaaaccccaggttgtcgtgtttgttggaacacttgtcagagat
tatgcagggataggcttaacaataactggtagctcaccatgcaaatggtatatcaatctg
gacatacctgacgtgctcaaattgaaagaaagcttcagtgtcaacttccagccaatcaaa
tgggttgaaaatgctgctcctgcattcaaccaagacactccagaggaaaaaaccattaaa
gaaattctaaaactaaatccgcacaaatataagcgagcacgttttattgtcaatgttact
atcaagagcatacatgatgaaaactgctggtggtacaattcatgtgaccgatgctgcaga
acttcaaagccatatggttctacctatagatgctctagctgttgttatataggaatgcca
gtgccaagatacaaagttgtgctcactaccgcagacaacacttctgaagctgcatttgtc
ctcttcggacgaattgcacatcgcctaatacacagaccagtggagtctctaatcgaagaa
aatccacctgactttatcccagctgagatccaagctcttgtagatcaagcctttgtatgg
aatgtcagcttcactgaacacacagttaaacggaatcaagaatccttacaggtcaatagc
attgtatcatctggtgccccaaaacagcacttcctgcctatctcaccgtctgcttcagga
cgcacctcaactatcgtaccactgagccctggcacttcactccaaacaccacccgcagca
agcgaaagcagtattgaatcacagtcatcaaccagaggaaagcaaagtgcatctctacag
ccaagtctatcaacaccaacaaaatatgttgttagcgctgcagcagatgacacaccaact
agcaagtccaacccctcaggatccaccaaaaagaaatatgttgtcttagcatatcctatg
caatctcaaacaatgcagccttccattgatgataaggttagtattccaccagttatacta
atattcagcctattttcagcactaccttacaagcaatctaatctcctacttaattttgca
aggccacaaagccaaagagtggacagaaaactttggaacatccatctcttcctgcagctg
gaccatctgaatctgaatctgaacataagatcaaaggaacttttgtcaatacacctgatg
atccacctattagcccttctgtgcctagcaaaagtgcaagcaaaaaaaggtacctatgga
ctgcttgcctacagcgcatcagtgatagatgcttacaatattggtaatttaactgactgt
tataacctaatattacacaggaccaacactatagcttcagttccagctccacctgctaag
aagctattcaaagaacattcccagcacacaaaggatcaaaggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280671
Entry
107280671         CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit-like
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107280671
   03420 Nucleotide excision repair
    107280671
   03430 Mismatch repair
    107280671
   03440 Homologous recombination
    107280671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    107280671
   03032 DNA replication proteins [BR:osa03032]
    107280671
   03400 DNA repair and recombination proteins [BR:osa03400]
    107280671
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    107280671
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    107280671
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     107280671
   MMR (mismatch excision repair)
     107280671
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     107280671
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2
Other DBs
NCBI-GeneID: 107280671
NCBI-ProteinID: XP_015634947
LinkDB
Position
4:complement(30499106..30501605)
AA seq 408 aa
MIKLNKRTCIIEAKDQPMDFPKYTFDLVSFDKLHDFTSKTDRFLDVIGKIIAVSNAAMIS
TSSSDYRMRRIVKLQDLSGKTIDLSLSGKRAVEFDGETILEVGQNNHIIAIFVGTSMKIL
KGTYEFLSGTTACRWYINENDIPEIKMFQKCLPPHADPIQKLYLQSDEDMQRSIEHKTLA
ELKEIDPFVDKDEKYQCTATIIGIQERKTWCYQACKLCNCKMIWDGSILKCKKENCPCRQ
YEYKYKIPFIANDGTASLELVLFEKKGTELIGRTAETMKRQYDINQTPPEIKAWIGHKFT
FIVKVLPNITINADEPSFEVLTIKERFGRQHSSQGFKATKNLPISSSSSQQLHNLPPLVP
ILSKKIQHEIEPPQDIQSMEVEPYNLETSTLSGKRAYEDPNSTDQVNN
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgatcaaactaaacaaaagaacttgtatcattgaagccaaagatcaacctatggatttt
ccaaagtatacatttgacttggtgtcatttgataaacttcacgatttcacaagcaagact
gatcgttttctagatgttattggaaaaatcattgctgtttctaatgcagcaatgatttct
acaagttcatcagattataggatgagaagaatagtcaaactacaagatttaagtggaaaa
accatcgacctctcattatcaggaaaaagagctgttgagtttgatggagagacaatactg
gaagttggtcaaaataaccatataatagcaatatttgttggtacatcaatgaaaatcctt
aagggaacatatgaatttctaagtggaacaacagcttgtcgttggtatatcaacgaaaat
gacatccctgaaatcaagatgtttcagaaatgccttccaccacatgctgatcctatacaa
aagctatacttgcaaagtgatgaagatatgcaacggagcattgaacacaaaacacttgca
gaattgaaggaaattgatccttttgttgacaaggatgaaaaataccagtgcactgctact
atcattggaattcaggaaagaaaaacttggtgttatcaagcctgtaaattgtgcaattgc
aagatgatatgggatggttctatattaaaatgcaagaaagagaactgcccatgtaggcag
tatgagtacaagtacaaaataccattcattgcaaatgatggcacagctagccttgaactt
gtgctatttgaaaagaaaggtacagaacttattggtaggactgctgaaactatgaaaagg
caatatgatatcaatcaaacacctccagaaataaaagcatggataggacataaattcaca
ttcatagtgaaggttttgccgaacataactatcaacgctgatgaaccttcatttgaggtg
ctgacaattaaagaaagatttggaaggcaacattccagccaaggctttaaggcaactaag
aatcttcccatcagttcaagttcatctcaacaactacataatttacctccactggtgcct
atactatccaagaaaatacaacatgagatagaaccaccccaagatattcaaagcatggaa
gttgaaccatataatttagaaacaagcactttgtcaggaaaaagagcttatgaagatcca
aacagtacagatcaggtaaacaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325130
Entry
4325130           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein At4g28440
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4325130
   03420 Nucleotide excision repair
    4325130
   03430 Mismatch repair
    4325130
   03440 Homologous recombination
    4325130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4325130
   03032 DNA replication proteins [BR:osa03032]
    4325130
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325130
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4325130
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4325130
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4325130
   MMR (mismatch excision repair)
     4325130
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4325130
SSDB
Other DBs
NCBI-GeneID: 4325130
NCBI-ProteinID: XP_015621971
UniProt: Q5JML8 Q0JJ87
LinkDB
Position
1:complement(31638604..31640497)
AA seq 140 aa
MAAAAAAAKRKPVFVKVDQLKPGTGGHTLVAKVLSSKTVVQKGRAAAGAGPAARPTRIAE
CLIGDETGCILFTARNEQVDLMKADSTVIIRNAKIDMFKGSMRLAVDKWGRIEVTEPASF
NVKEDNNLSLVEYELVNVEG
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcgaagaggaagccggtgttcgtcaaggtggaccagctc
aagcccggcacgggcggccacacgctcgtcgccaaggtgctcagctccaagaccgtggtc
cagaagggccgcgccgccgcgggagcgggcccggcggcgcgtcccacgaggatcgccgag
tgcctcatcggcgacgagaccggctgcatcctgttcaccgcccgcaacgagcaggttgac
ctgatgaaggctgacagcactgttattatccgcaatgcaaaaattgatatgttcaaagga
tcaatgaggcttgctgtggacaaatggggccgcattgaagtgactgaaccggcaagtttc
aacgtaaaggaggataacaatctctcacttgtggagtatgaacttgtcaatgttgaaggg
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326359
Entry
4326359           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein At4g28440
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4326359
   03420 Nucleotide excision repair
    4326359
   03430 Mismatch repair
    4326359
   03440 Homologous recombination
    4326359
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4326359
   03032 DNA replication proteins [BR:osa03032]
    4326359
   03400 DNA repair and recombination proteins [BR:osa03400]
    4326359
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4326359
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4326359
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4326359
   MMR (mismatch excision repair)
     4326359
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4326359
SSDB
Other DBs
NCBI-GeneID: 4326359
NCBI-ProteinID: XP_015632156
UniProt: A0A0N7KCM7 Q9FTU2
LinkDB
Position
1:7670062..7672760
AA seq 141 aa
MSTPAAGEKPALRKPVFTKVDQLKPVTSGHTLTVKVVSATPVPGRARPGVAAPSRPPRIA
ECLIGDETGAIVFTARNEQVDLLKPGATVIMRNAKIDMFKGSMRLAVDKWGRIEATEPAS
FTVKEDNNLSLVEYELVNVTE
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtcgacccccgccgcgggcgagaagccggcgctgaggaagccggtgttcaccaaggtc
gaccagctcaagccggtcaccagcggccacaccctcaccgtcaaggtcgtcagcgccacc
cccgtcccgggccgcgcgcggccgggcgtcgccgccccgtcccgccccccgcgcatcgcg
gagtgcctcatcggcgacgagaccggcgccatcgtcttcaccgcccgcaacgagcaagtt
gacttgttgaagcctggtgctacagtgatcatgcgcaatgccaaaatcgacatgttcaaa
ggctcaatgaggcttgcggtggacaagtgggggcgtatagaggctacagaacctgccagc
tttactgttaaggaggacaacaacttgtcactagtagagtatgagttggttaacgtgacc
gagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327373
Entry
4327373           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit B-like
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4327373
   03420 Nucleotide excision repair
    4327373
   03430 Mismatch repair
    4327373
   03440 Homologous recombination
    4327373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4327373
   03032 DNA replication proteins [BR:osa03032]
    4327373
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327373
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4327373
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4327373
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4327373
   MMR (mismatch excision repair)
     4327373
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4327373
SSDB
Motif
Pfam: REPA_OB_2 DUF223 Rep_fac-A_C
Other DBs
NCBI-GeneID: 4327373
NCBI-ProteinID: XP_015621596
LinkDB
Position
1:35938434..35949996
AA seq 439 aa
MSAKMAFDLLCDISPASRGWKIRAKIARMWDYTGTADDLPPIHVDLVLIDEKGNAMYAEI
PGVEADKFRPLLQESKVYTFSKFLILPSKPAYKPFPNKYMIKLTPWTNVEQVNEVPADFP
SHVFNLVQFSYLSLRVGMQEYFTDVIGMIIGVSKLAYVRMASKTSDTPKRVIALRDLANC
EVKLVLWGEHAPDFDADAVHSVGQDNAVVGIFVDTLMKAYNNEETLSGGSACKWYLNEDI
PEINQFFDSLGDSAPKIQWISTGAESFGSSQRPARLEHKSVADLKKIDPWEAAGAGFSCT
VTIAKLSPSQSWWFSSCSRCHRAATAYGSSYKCSSGCSSVTAIPKYRLCLIGTDGTNSAE
FVLFGRVAQQVVGRPVMNLIKFQGRSDNIPKEIAAVVSQKFTFAVSVTERSLMHRNISFQ
VNGIETFFGRQGSIPQPRE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcggctaagatggctttcgatttgctgtgtgacatatccccagcaagcagaggctgg
aagatccgtgcaaagatagcaagaatgtgggactacactggtacagctgacgatctgcct
cctatacatgttgatctggtgcttattgatgagaagggaaatgcaatgtatgctgaaatt
ccaggcgttgaggctgataagttcagaccacttcttcaggaatcgaaagtctacactttt
agcaagttccttattttgcctagcaaacctgcatacaagcccttccctaacaagtatatg
atcaagcttactccatggacaaacgtggaacaggtcaatgaagttcctgctgatttccca
tcccatgtgtttaatttggttcaattctcatatctaagcctgcgcgttgggatgcaagag
tacttcactgatgtgatcggtatgatcattggggtatcaaagctagcctatgtccgaatg
gcgtctaaaacgtcagacacacctaagagggtcattgctctaagggatcttgcgaactgt
gaggttaaacttgtcctatggggagagcatgctcccgactttgatgctgatgctgttcat
agtgttggccaagataatgctgtcgttggtatctttgttgatactcttatgaaagcatat
aataatgaagaaactcttagtggaggatcagcctgcaaatggtatttaaatgaggacata
ccagagataaaccagttctttgatagcctgggtgatagtgctccaaagatccagtggata
tcaaccggagcagagtcctttggttcgtcacaacgcccagcacggttggagcataaatct
gttgctgaccttaaaaagattgatccatgggaagctgcgggtgctggcttctcatgtact
gtgaccatagctaagttgagcccatctcagtcatggtggttttcatcctgttcccgttgt
catagagccgcaactgcatatggatctagctataaatgctccagcggttgctcatcagtt
actgccattccaaagtaccgtctttgcctgataggaaccgatggaactaattcagcagag
tttgtgctatttggacgtgttgcgcagcaagttgttggccgtcctgttatgaatcttatc
aaatttcagggcagatcagacaatattcctaaagaaattgctgctgttgtttcacagaaa
tttacctttgctgtctctgtcactgagcggagccttatgcacaggaatatatcttttcaa
gttaatggaatcgagactttctttggaagacagggttctattccgcagcctagggaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327706
Entry
4327706           CDS       T01015                                 
Name
(RefSeq) replication protein A 14 kDa subunit
  KO
K10740  replication factor A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4327706
   03420 Nucleotide excision repair
    4327706
   03430 Mismatch repair
    4327706
   03440 Homologous recombination
    4327706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4327706
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327706
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4327706
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4327706
   MMR (mismatch excision repair)
     4327706
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4327706
SSDB
Motif
Pfam: Rep_fac-A_3
Other DBs
NCBI-GeneID: 4327706
NCBI-ProteinID: XP_015626750
UniProt: Q9SDK9
LinkDB
Position
1:complement(8396498..8398632)
AA seq 106 aa
MDTSGPAAFVNGEILKMFVGRRVRTVVQAQREEGGLLIGQSTDGHQLTIKGASGAPMSHY
VEIIGIAEPNQAIRAEVCTDFGENFDPAPFNGLCKLANGQMKDLFL
NT seq 321 nt   +upstreamnt  +downstreamnt
atggatacatcaggacctgcagcattcgtcaatggagagattctgaagatgttcgtcggc
cgaagagtgcgcacggtggtccaagcccagcgcgaggaaggcgggttgcttatcgggcag
tccaccgatggtcatcagctaaccatcaaaggggcctccggtgcccctatgtcgcactat
gtggagattattgggatcgctgaacccaatcaggccatccgggctgaagtttgcacagat
tttggtgaaaacttcgatcctgcaccattcaatggactgtgcaagcttgcgaatggccag
atgaaggatttgttcctgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330068
Entry
4330068           CDS       T01015                                 
Name
(RefSeq) replication protein A 32 kDa subunit B isoform X2
  KO
K10739  replication factor A2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4330068
   03420 Nucleotide excision repair
    4330068
   03430 Mismatch repair
    4330068
   03440 Homologous recombination
    4330068
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4330068
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330068
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4330068
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4330068
   MMR (mismatch excision repair)
     4330068
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4330068
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 SnoaL_4 PCI
Other DBs
NCBI-GeneID: 4330068
NCBI-ProteinID: XP_015625648
UniProt: Q6H7J5 A0A7D5BIZ9
LinkDB
Position
2:complement(25404409..25408583)
AA seq 298 aa
MYGVGVGGGGGGNYDGGGGNASSLFGGGGFMPSQATNAAEGTSGGGGGFPKSRNAQALLP
LTVKQIMDASQTNDDKSNFAVNGMEVSTVRLVGRMLNKLDRVTDVSFTLDDGTGRVPVNR
WENDSTDTKEMADIQNGDYVIVNGGLKGFQGKRQVVAYSVRRITNFNDVTHHFLHCVHVH
LELTRPKSQVNANTATGTPNQTMPRDSMAYNQSPLTNQASTFSAPQNTGTGTNMIDLVLN
VFHDPAVMNDDHGVGVDYVSRRLNLPEETVGKIIIDQVDLGHLYATIDDHHYKSTMNG
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtacggcgtcggcgtcggcggcggcggcggcgggaactacgatggcgggggagggaac
gccagctccctcttcggcggcggcggattcatgccctcgcaggcgaccaacgccgcggag
gggaccagcggcggcggcggcggcttccccaagagtcggaacgcccaggcgctgctcccg
ctcaccgtgaagcagatcatggacgcgtcccagaccaacgacgacaagtcgaattttgct
gtcaatggcatggaggtgtccacggttaggcttgtaggacgcatgttaaataagcttgat
cgggttacggatgtatcattcactcttgatgatggtacaggcagggtacctgtgaatcgc
tgggaaaacgatagcactgatactaaggagatggctgacattcagaatggtgactatgtt
attgtcaatggtggtctaaaaggttttcaagggaagcgtcaggtggttgcttactctgtg
aggcgtataaccaacttcaatgatgtaacacatcactttcttcactgcgttcatgtgcac
ttggagcttaccaggccgaagtcccaagtaaatgctaatacagcaacaggaactcctaac
caaactatgcctagggatagcatggcgtataaccaaagtccacttactaatcaggcctca
acattttctgcaccacaaaatactggtactggaacaaatatgatcgacttggtcttgaat
gtttttcatgacccagcagttatgaatgatgaccatggagtaggcgtagattatgtgagc
cgtcgtcttaatctaccagaggaaacagtcgggaaaatcattatagaccaagttgatctg
ggacatttgtatgccactatcgatgaccaccattacaagtccacaatgaatggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330902
Entry
4330902           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit A
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4330902
   03420 Nucleotide excision repair
    4330902
   03430 Mismatch repair
    4330902
   03440 Homologous recombination
    4330902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4330902
   03032 DNA replication proteins [BR:osa03032]
    4330902
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330902
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4330902
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4330902
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4330902
   MMR (mismatch excision repair)
     4330902
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4330902
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon CDC24_OB3
Other DBs
NCBI-GeneID: 4330902
NCBI-ProteinID: XP_015625818
UniProt: Q6YZ49
LinkDB
Position
2:complement(32832938..32836475)
AA seq 656 aa
MAMARLTPNGVAAALAGDTNLKPVLQIVELRGVQVNGAGVTRGERFRAVVSDGTAASSAL
FAAQLSDHARSGALRRGSIVQLSEYVINEVGPRRIIVILNLEVLVSECEIIGNPTALSET
GSPIPNPTRVEQFNGAPQYGLMAGNSSNTTTKPSDNVPLFQNSMAGNSSNFATRPSDKVP
VFQPTVQPSYRPAPNYKNHGAIMKNEAPARIIPISALNPYQGRWAIKARVTAKGDIRRYH
NAKGDGKVFSFDLLDSDGGEIRVTCFNALLDRFYEVVEVGKVYVVSRGNLRPAQKNYNHL
NNEWEILLENGSTVDLCPDENSSIPTQRFDFRPINEIEDAQNNAILDIIGVVTSVNPCTT
IQRKNGMETQKRTMNLKDMSGRSVEVTMWGDFCNREGSQLQGMVERGIFPVLAVKAGKVS
DFSGKSVGTISSTQLFINPDSAEAHSLRQWFDSGGRDASTQSISRDITPGASRNEIRKTV
AQIKDEGLGMGDKPDWITVKATVIFFKNESFFYTACPNMIGDRQCNKKVTKSTNGNWTCD
KCDREFEECDYRYLLQFQIQDHSGTAWVTAFQEAGQELLGCSATELNALKEREDPRFADT
MLNCLFQEYLLRLKVKEESYGDERKVKNTAVKVEKVDPSGESKFLLDLISKSSALH
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggcgatggcgaggctgacgccgaacggcgtggcggcggcgctggcgggggacacgaac
ctgaagccggtgctgcagatcgtcgagctgcggggcgtccaggtcaacggcgcgggcgtc
acgcgcggggagaggttccgggcggtggtctccgacggcaccgccgcgtcctccgcgctc
ttcgccgcgcagctcagcgaccacgcccgatccggcgccctccgacgcggcagcattgtg
cagctcagcgagtacgtcatcaacgaagtcggccccagaaggattattgtcattctgaac
ctggaagttcttgtttcggagtgtgagataattgggaatcctacagcgctttcagaaact
ggatctcctatcccaaatccgacaagagtagagcaatttaacggagcacctcaatatggt
ttgatggcagggaactcatcaaatacaaccacaaagcctagtgacaatgttccattgttc
caaaattcgatggcaggaaactcctctaactttgccactaggcccagtgacaaagttccg
gtcttccaaccaacagtccagccatcttatcgccctgcacctaattacaaaaaccatgga
gcaatcatgaaaaatgaagcccctgctagaataatccccatatctgctttaaatccttat
caaggccgctgggctatcaaggctagagttactgccaagggagatatccgccgataccat
aatgctaaaggtgatgggaaagtattctcttttgacttgcttgattctgatgggggagag
atacgggtgacatgcttcaatgctcttcttgatcgattctatgaagttgtggaagttggt
aaggtctatgtggtatcaagaggaaacttgagacctgcacagaagaactataaccatctt
aacaatgagtgggagattttattggagaatggatcaactgtggatctttgtcctgatgag
aacagttccattcccacccagcggtttgacttcagaccgatcaatgaaattgaggatgcc
cagaacaatgctatccttgacatcataggtgttgttacatcggtcaatccttgcaccaca
atacagaggaaaaatggcatggaaactcagaaaagaactatgaacctgaaggatatgtct
ggtcgaagtgttgaggtaaccatgtggggtgacttttgcaacagagaaggctcacagctt
caaggaatggttgaacgtgggatctttcctgtgctggctgtcaaagcaggaaaagtgagt
gatttcagtggcaagtctgtcggcacaatttcttcaactcagctcttcatcaaccctgat
tctgctgaagctcatagtctcaggcaatggtttgatagtggaggaagagatgcttctact
cagtccatatccagagatatcacgcctggagcatcaaggaatgagatccgaaagacagta
gcacagatcaaggatgaaggtcttggaatgggggacaaacctgactggattacggtgaaa
gccaccgttatattcttcaagaatgagtccttcttctacacagcttgccctaacatgatt
ggcgacaggcagtgcaataagaaggtgacaaagagtactaatggcaattggacctgtgac
aaatgcgatagggagtttgaagagtgcgactacaggtatctcctgcagtttcagattcaa
gatcactcgggaacagcttgggtgacagcattccaggaggctgggcaggagttgcttggc
tgctcggcaacagagctcaacgcacttaaggagcgcgaggaccctcggtttgcagacacc
atgctcaattgcttgtttcaggaatatctgctcaggctgaaggtcaaagaagaatcatac
ggcgatgagcgcaaagtgaagaacaccgcggtcaaagtggagaaggttgatccttcgggt
gaaagtaaatttctgctggatttgatctccaagtcctcggcgctacattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331236
Entry
4331236           CDS       T01015                                 
Name
(RefSeq) replication protein A 32 kDa subunit A
  KO
K10739  replication factor A2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4331236
   03420 Nucleotide excision repair
    4331236
   03430 Mismatch repair
    4331236
   03440 Homologous recombination
    4331236
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4331236
   03400 DNA repair and recombination proteins [BR:osa03400]
    4331236
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4331236
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4331236
   MMR (mismatch excision repair)
     4331236
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4331236
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 Sfi1_C
Other DBs
NCBI-GeneID: 4331236
NCBI-ProteinID: XP_015624204
UniProt: Q6K9U2
LinkDB
Position
2:complement(35639825..35642608)
AA seq 279 aa
MMSFSQPDAFSPSQFTSSQNAAADSTTPSKSRGASSTMPLTVKQISEAQQSGITGEKGAP
FVVDGVETANVRLVGLVSGKTERNTDVSFTIDDGTGRLDFIRWVNDGADSAETAAVQNGM
YVSVIGSLKGLQERKRATAFAIRPVTDYNEVTLHFIQCVRMHLENTKSQIGSPAKTYSAM
GSSSSNGFSEMTTPTSVKSNPAPVLSVTNGSKTDLNTEVLNVFREPANVESEHGVHIDEI
VKRFRLPEAKIKVAIDYLADIGHIYSTIDESHYKSAFNE
NT seq 840 nt   +upstreamnt  +downstreamnt
atgatgtccttcagccagcccgacgccttctcgccgtcgcagttcacctcctcccagaat
gccgccgccgactctaccaccccttccaagagccggggcgcatcgagcaccatgccgctc
accgtgaagcagatctctgaagcgcagcaatctggcatcaccggggagaagggcgctccc
ttcgtcgtcgacggcgtcgagacagccaacgttaggcttgtgggattggtcagtggcaag
acggagcggaacaccgatgtgtccttcacgatcgacgatggcaccggccgcctcgatttc
atcagatgggtcaatgatggtgctgattctgctgaaaccgctgctgttcagaatggaatg
tatgtttctgtcattggtagcctcaaggggcttcaggagaggaagcgtgctactgctttc
gctatcaggcctgtaactgattataatgaggtcacactgcatttcattcagtgcgtgcga
atgcatttagagaacaccaaatcacagattggtagccctgcaaaaacatattctgccatg
ggatcctcatcttccaatggcttcagtgaaatgaccactccgacctctgtgaaatccaac
ccggcaccagtgctcagtgtaacaaatggatcaaaaactgatttgaacacagaagtgctg
aatgttttccgcgaaccagcaaacgtcgagagcgagcatggtgtgcacattgatgaaatc
gtgaagcgcttcaggctaccggaggccaagatcaaggtagctattgattacctcgctgac
attgggcacatatactcaacaatcgacgagtctcactacaagtcagcgttcaatgaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332052
Entry
4332052           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit B
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4332052
   03420 Nucleotide excision repair
    4332052
   03430 Mismatch repair
    4332052
   03440 Homologous recombination
    4332052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4332052
   03032 DNA replication proteins [BR:osa03032]
    4332052
   03400 DNA repair and recombination proteins [BR:osa03400]
    4332052
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4332052
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4332052
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4332052
   MMR (mismatch excision repair)
     4332052
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4332052
SSDB
Motif
Pfam: Rep_fac-A_C Rep-A_N REPA_OB_2 tRNA_anti-codon DUF223 BRCA-2_OB3
Other DBs
NCBI-GeneID: 4332052
NCBI-ProteinID: XP_015628911
UniProt: Q10Q08
LinkDB
Position
3:5979571..5983095
AA seq 630 aa
MDSDAAPSVTPGAVAFVLENASPDAATGVPVPEIVLQVVDLKPIGTRFTFLASDGKDKIK
TMLLTQLAPEVRSGNIQNLGVIRVLDYTCNTIGEKQEKVLIITKLEVVFKALDSEIKCEA
EKQEEKPAILLSPKEESVVLSKPTNAPPLPPVVLKPKQEVKSASQIVNEQRGNAAPAARL
AMTRRVHPLISLNPYQGNWIIKVRVTSKGNLRTYKNARGEGCVFNVELTDVDGTQIQATM
FNEAAKKFYPMFELGKVYYISKGSLRVANKQFKTVHNDYEMTLNENAVVEEAEGETFIPQ
IQYNFVKIDQLGPYVGGRELVDVIGVVQSVSPTLSVRRKIDNETIPKRDIVVADDSSKTV
TISLWNDLATTTGQELLDMVDSAPIIAIKSLKVSDFQGLSLSTVGRSTIVVNPDLPEAEQ
LRAWYDSEGKGTSMASIGSDMGASRVGGARSMYSDRVFLSHITSDPNLGQDKPVFFSLNA
YISLIKPDQTMWYRACKTCNKKVTEAIGSGYWCEGCQKNDAECSLRYIMVIKVSDPTGEA
WLSLFNDQAERIVGCSADELDRIRKEEGDDSYLLKLKEATWVPHLFRVSVTQNEYMNEKR
QRITVRSEAPVDHAAEAKYMLEEIAKLTGC
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggattccgacgcggcaccgtcagtgacgccgggggcggtggcgttcgtcctggagaac
gcgtcgccggacgcggccaccggcgtgccggtgccggagatcgtcctccaggtcgtcgac
ctcaagcccatcggcacccgcttcactttcttggcgagcgatggcaaggacaagataaag
acgatgcttctcacccagctcgctccggaggtgcgctccggcaacatccagaatctcggc
gtcatccgcgtcctcgactacacctgcaacaccatcggcgaaaagcaggaaaaggtcttg
attatcacgaagctcgaggtcgtgttcaaggcgctggattccgagatcaagtgcgaggcc
gaaaagcaagaggagaagccggcgattctgttgagtcccaaggaggaatccgtggttctc
tccaagcccacgaacgcgccgccacttcctccggttgtgctgaagcccaagcaggaggtg
aagtccgcgtcccagatcgtgaacgagcagcgcggcaatgctgctcctgcggcgcggttg
gccatgacgagaagagttcatcctttgatctccctgaacccctaccagggcaactggatc
atcaaggtgcgtgtcacaagcaagggcaacctgaggacgtacaagaatgctcgtggtgaa
ggctgcgtcttcaatgtggagctcactgatgtggatggcacccagatccaggcaaccatg
ttcaacgaggctgccaagaagttctatccgatgtttgagctggggaaggtgtactacatc
tccaaaggatctctcagagtcgccaacaagcagttcaagactgtccataatgactacgag
atgaccctgaatgagaatgctgttgttgaggaagctgagggcgaaacttttatcccacag
attcagtacaactttgtcaagattgatcagctagggccatatgttggtggcagggagcta
gtagatgttattggggttgttcagagcgtatctcctactcttagtgttaggaggaagatt
gacaacgagacgattccaaagcgtgacatcgttgtagcggatgactcgagcaaaactgta
accatatctctttggaatgatcttgccacaactactggtcaggagctcttggacatggta
gactctgcgcctatcattgcgataaagagcctaaaagtatctgacttccaaggtttgtct
ctgtcaactgtggggagaagtacaattgtagtgaatcctgacttgcctgaggcagaacag
ctcagagcttggtatgactctgaaggcaagggtacttcaatggcatcaattggttcagat
atgggcgcatcaagggttggtggcgcgagatccatgtacagtgatagagtttttctgtct
cacatcacaagtgaccccaacttgggtcaggataagcctgtgttcttcagtctgaatgcc
tatattagccttatcaagcctgaccaaaccatgtggtaccgagcttgcaagacctgcaac
aagaaggtgactgaggcaattggatcaggatactggtgtgaagggtgccagaagaatgat
gctgagtgctcactgaggtacatcatggtcatcaaggtctccgaccctactggtgaggcc
tggctttctctgttcaatgatcaggcagagaggattgttggctgcagtgcagatgagctt
gatcggattaggaaggaggagggtgatgacagttaccttctcaagctgaaggaagctact
tgggttcctcacctgttccgcgtcagcgtaactcagaatgagtacatgaatgagaagagg
cagaggatcactgtgaggagtgaagctccggtagaccacgcagctgaagccaagtacatg
ctcgaggagatagccaagctgacaggttgctag

DBGET integrated database retrieval system