KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107279948
Entry
107279948         CDS       T01015                                 
Name
(RefSeq) WD repeat-containing protein RUP2-like
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107279948
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    107279948
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    107279948
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107279948
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107279948
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     107279948
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 107279948
NCBI-ProteinID: XP_015624242
UniProt: Q6Z7B5
LinkDB
Position
2:complement(794686..796981)
AA seq 404 aa
MSNPSSPATSTAAGEQQLHDQDHRDEAALQQEHAAAGIIPDDEDKLSPPRCEWEFRLAAT
VPSPALAGASDSIGSLDFDPTGRHLATGGIARKIRIYRVAEPSSPAACICVPAKLSSVRW
RPGGGEAVAASHVGCGDYDGVVTEYDVERGVPVWERDEHEGRRVWALDYARGGGAATMVA
SGSDDRTAHVWDPRAPAGAAGSWATARAGGAVLCVEFDPAGGPQLAVGSADRRAAVHDVR
ALGRGAVASMDGHGRAVTYVRWAATARRVVTSAADGTHRLWALPAPAAAETAAREVRSYS
GHVSGRSFVGMGVWRGAGLIASGSESGHVFVYDLRWSKPIWVHPFSHADAFVSAVAWRQL
AGDDSDGQLVAGGSDGVLKLFTTHRRLTPDVAGVGGDDDDDVAA
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgagcaacccctcctcgccggccacgtccaccgccgccggggagcagcagctgcacgat
caggatcaccgggacgaggcggcgctgcagcaagaacacgccgccgccggcattattccc
gacgacgaggacaagctgtcgccgccgaggtgcgaatgggagtttcgcctggcggccacc
gtgccgtcgccggcgctcgcgggcgcgtccgactccatcggcagcctcgacttcgacccc
accggccgccacctcgccaccggcggcatcgcccggaagatccggatttacagggtcgcc
gagccgtctagccccgccgcctgcatctgcgtcccggccaagctgagcagcgtgcggtgg
cgccctggcggcggcgaggcggtggcggcgtcgcacgtggggtgcggcgactacgacggc
gtcgtgacggagtacgacgtggagcgcggcgtgccggtctgggagcgcgacgagcacgag
gggcggcgggtgtgggcgctcgactacgcccgcggcggcggcgcggcgacgatggtggcg
tccgggtcggacgaccggacagcccacgtgtgggacccgcgcgccccggctggcgcggcg
gggtcgtgggcgacggcgcgcgccggcggcgccgtgctgtgcgtggagttcgaccccgcc
ggcgggccgcagctggcggtgggctccgccgaccgccgcgccgcggtgcacgacgtgcgc
gcgctggggcgcggcgcggtggcgtccatggacggccacggccgcgccgtgacgtacgtc
cggtgggcggcgacggcgcggcgggtggtgacgtcggcggcggacggcacccaccgtctg
tgggcgctgccggcgccggcggcggcggagacggcggcgagggaggtgcggtcgtacagc
ggccacgtcagcgggcgaagcttcgtggggatgggggtgtggcgtggcgcggggctgatc
gccagcggctccgagtccggccacgtcttcgtctacgacctccgctggtccaagcccatc
tgggtccacccattctcccacgccgacgccttcgtcagcgcggtcgcatggcgccagctc
gccggcgacgacagcgacggccagctcgtcgccggcggctccgacggcgtgctcaagctc
ttcaccacccaccgccgtctcacccccgacgtcgccggcgtcgggggcgacgacgacgac
gacgtggctgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324761
Entry
4324761           CDS       T01015                                 
Name
(RefSeq) DNA excision repair protein ERCC-8 isoform X1
  KO
K10570  DNA excision repair protein ERCC-8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4324761
  09124 Replication and repair
   03420 Nucleotide excision repair
    4324761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4324761
   03400 DNA repair and recombination proteins [BR:osa03400]
    4324761
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     4324761
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      4324761
SSDB
Motif
Pfam: WD40 NBCH_WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 4324761
NCBI-ProteinID: XP_015611747
LinkDB
Position
1:37076378..37091411
AA seq 473 aa
MWCEAVRWREHGELGARRFETAARARRTASLALSNRKEFTTPHNGAINSLQVDLTERRYL
LAGASDGSAAIFDVQNATEYEAGFIAKHRSILLVDKQHENGHKFVVSMAVWYPVDTGLFV
TASFDQYVKVWDTNSTQVVMDFKMPGKVYSAAMSPIATTHMLIATGSADVQVHLCDIASG
AFTHTLSGHRDGIMSLEWSTSSEWILMSGGCDGAIRFWDIRRAGCFLVLDQSRSQLGRRP
PFLEGTSDKDPLNSLQPSSSSKIYSAQQRTGKSKKQSHKLHKSQIPGHGHIQQRLHPGLS
SSQNCATAHYGAVTGLRTTTDGMYLLSSGSDSRLRLWDIDSGCNTLVNFEAMRLQTSKPL
QLAVTEDPSLVFIPCMASIKAYNLWSGMTFQTFRGHYEPVNCCYCSAQEQELYTGSNDMQ
ILVWSPSTPAFTEMVYFLFLVIIYLSVEFSYILSNSNFLGVVGHIRILSHKLF
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtggtgtgaggcggtgaggtggagggaacacggggagctgggcgcacggcgcttcgag
accgccgcccgggcgcgccgcaccgcctcgctcgcgctctccaaccgcaaggagttcacc
accccgcacaacggcgccatcaactccctccaggttgatttgacagagcggcggtaccta
ctcgctggcgcatcggatggatcagccgctatattcgatgtgcagaatgcaaccgaatac
gaagccgggttcattgccaagcacaggagcattctgcttgtggacaagcagcatgaaaat
ggccacaagttcgtggtatcgatggccgtatggtatcctgtggacactgggctgttcgtg
acagcttcttttgatcagtatgtcaaagtgtgggatactaattcgactcaagtcgtaatg
gattttaagatgcctggaaaagtgtatagcgcagcaatgtccccaattgcaacaacacat
atgctgatcgctactggaagtgcggatgttcaggtccatttatgtgacattgcttctgga
gcctttacccacacgttgtccggtcatcgtgatggtatcatgtctttggagtggtctact
tcaagtgagtggattttgatgagcggtggttgtgatggagcaatacgattttgggacata
agacgagctggatgctttcttgttcttgatcagtcacggtctcaactaggaaggcggcct
ccttttcttgagggcacctcagataaggatcctttgaactctttacaaccttcatcttct
tcaaagatttactctgcacagcagaggacaggcaagagtaagaaacagtcacacaaattg
cacaaaagtcaaatccctggacatggacatatccaacagagattgcaccctggtttgtct
tctagtcaaaattgtgcaacggcacattatggtgctgttacaggattaagaacaactaca
gatgggatgtaccttcttagctcaggttctgattctcgcttaagactttgggatattgat
tcaggctgcaatactttggtcaattttgaagctatgcgattacagactagcaaaccgcta
caattagctgtcactgaggatccatcacttgtattcatcccatgcatggcaagcattaag
gcgtacaatttatggtctggtatgacatttcaaacattccgggggcactatgaacctgtt
aattgctgctactgtagtgcacaagaacaagagctttatactggcagcaatgacatgcaa
attcttgtgtggtctccatcaactccagcgtttactgaaatggtatattttctatttctt
gttatcatatatctttctgtagaattttcctatatcctatcaaattcaaatttcttagga
gtagtcgggcatattaggatattatcgcataagcttttttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325482
Entry
4325482           CDS       T01015                                 
Name
(RefSeq) protein DAMAGED DNA-BINDING 2
  KO
K10140  DNA damage-binding protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4325482
  09124 Replication and repair
   03420 Nucleotide excision repair
    4325482
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4325482
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325482
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     4325482
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      4325482
SSDB
Motif
Pfam: WD40 PQQ_3
Other DBs
NCBI-GeneID: 4325482
NCBI-ProteinID: XP_015622245
UniProt: Q84KJ3
LinkDB
Position
1:complement(2250837..2255147)
AA seq 583 aa
MGPTTRARFVHNRRRRRRRGPYAAPDDDDEEEDQQEASSSSSSSDEGEEDAEEEGSGEVD
DDDGEAAEPSGKEEEVSPVAAAARSGRKASITISLKKVCKVCKSTGHEAGFKGAVYIDCP
RKPCFLCKMPGHTTLTCPHRVAMEHGVIPASRRNTNTSLDYVFQSQVKGKIPMVKPQFLI
PNQLECGNIKFHQRRVTCLEFHPTKNNVLLSGDKKGLLGVWDYVKLHEKITYDSVHSCIL
NSMKFDTTNDGLLYTASSDGTISSTDLDTGIGSSLLNLNPNGWNGPSTWRMIYGMDFNSD
KGLLLVADSFGFLHLLDRRLKARIGDPILIHKKGSKVTSLHCNPAQPEVLLSSGNDHYAR
IWDTRKLEPNSAFVSLAHGRVVNSGYFSPQSGNKILTTCQDNRIRVWDYIFGNLESPSRE
IVHSHDFNRHLTPFKAEWDPKDHTETVAVIGRYISENYNGIALHPIDFIDTSTGKLLAEV
MDPDITTISPVNKLHPRDDILASGSSRSIFIWKPKTESDATEERNREKAKEFVYGSGSRK
KSNGKHENSSDDDSDGSCDGKKKKKAKKTRFTHTIKGKGKSKV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgggccctaccacccgcgcccgcttcgtccacaaccgccgccgccgccgccgccgcggg
ccgtacgccgcccccgacgacgacgacgaggaggaggaccagcaggaagcctcctcgtct
tcctcatcctccgacgagggagaggaggatgctgaggaggagggctccggagaagtcgat
gacgatgatggcgaagcggcggaaccctcgggtaaggaggaggaggtgtcccccgtggct
gcggcggcgaggagcgggaggaaggcctcgatcacaattagtctcaagaaagtgtgcaag
gtttgcaagagtacagggcatgaggccgggtttaagggagcagtgtatatcgattgcccc
aggaagccttgtttcctatgcaagatgccaggccatacaaccttgacatgcccacataga
gtagcaatggagcatggtgttatcccggcctctagaaggaacacaaacacttcactggat
tatgtgtttcagagccaagttaaaggcaagattcccatggttaagcctcagtttctgata
cccaatcaactggagtgtgggaacataaaatttcaccagaggcgtgtgacctgcttggaa
ttccatccaactaagaataatgtgcttttatcaggagacaagaaaggactattaggtgtt
tgggattacgtcaagttgcatgagaagattacttatgattctgtgcattcttgcattctc
aacagcatgaagtttgacactaccaatgatggattactatatacagcctcttctgatggt
actataagtagcacagacttggacactggaattggctcctctctgctgaatttaaatcca
aatggctggaatggtccgagcacttggcgcatgatttacgggatggactttaactctgac
aaaggtcttcttttggtggcggatagcttcggttttcttcacttgctggatagacggttg
aaggcaagaattggagatccaattcttatacataaaaagggtagcaaggttaccagcctc
cactgtaaccctgctcagcctgaagttcttctaagcagtggaaatgatcactatgcccgt
atttgggatacaaggaagctggagcccaactctgcctttgtgagccttgctcatggaaga
gttgttaattcaggatatttttccccacaaagtgggaataagatcttgacaacatgtcag
gataatcgaatccgtgtatgggattatatttttggtaatctggaatccccaagtagagag
attgttcacagccatgacttcaatcgtcacttgactcccttcaaagcagagtgggatcca
aaggatcacacagaaacagttgcagttattggtcgttacataagtgaaaactacaatggg
attgctctacatcccattgatttcatagacaccagtactgggaagcttctggctgaggtg
atggaccctgacattacaactatcagcccggtgaacaagctacatccgcgagatgatatc
ctggcttcaggaagttcaaggtccattttcatttggaaaccaaagactgaaagtgatgct
actgaagagaggaacagagagaaggcaaaggaatttgtatatggatcaggcagccggaaa
aaatcaaatggcaagcatgagaatagcagtgatgatgactcagatggcagttgtgatgga
aagaagaagaagaaagcgaagaagactcgcttcactcataccataaaggggaagggcaaa
tccaaggtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326296
Entry
4326296           CDS       T01015                                 
Name
(RefSeq) light-mediated development protein DET1 isoform X1
  KO
K10571  de-etiolated-1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4326296
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4326296
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     4326296
SSDB
Motif
Pfam: Det1
Other DBs
NCBI-GeneID: 4326296
NCBI-ProteinID: XP_015622107
LinkDB
Position
1:complement(248706..256873)
AA seq 512 aa
MATFFRSANLASRVFDRQFLSPRPGATVNTVRQFYENLVPSYTICDIDCPDYSFRKFTDD
GNYLVAFSRNHQDLIVYRPIWPTFSCNEPCDSHDLPPKAKKFDSFFKQLYSISLASSNEY
ICKDFFLYMECHQFGLFATSTAQSNDSSATEGAIHGVPSIEKITFYLVRLDDGAILDEKA
FRNDFINLAHSIGAYLYEDLLCIVSLRYQTIHVLQIRDSGNLVEVRKIGAFCQEDDELFL
HSHGQAARGVSFLPGIKQRLLSFIFRKTWNEESDQTLRVQHLKKKFYFHFQDYVDLIIWK
VQFLDRHHLFIKFGSVDGGVSRSTEQNSAFFAVYNMETTDIVSLYQNSSEELYSLFEYFY
DHFHTNPQNSSHGNFISSHSNNVHALDQLRTIKNKANSTSQQFVKKMMASLPYTCQSQSP
SPYFDLSLFRYDEKLISAIDRHRHCTEHPIKFISVKQPNVVKFKIKPGSDSGASDSRAKR
ISSFLFHPFFPLALSIQQTYMQPTVVNLHFRR
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcgaccttcttccgcagcgccaacctcgcctccagggtcttcgaccgccagttcctc
tccccacgccccggcgctactgttaacactgttagacagttctatgagaacttggttccg
agttacactatatgtgacatagattgcccagattattcatttcgtaaattcactgatgat
ggcaactatcttgtggcttttagccggaaccaccaagatttaatcgtgtaccgtcccatc
tggccaacattttcatgcaatgagccatgcgactctcatgatcttccacccaaagcaaag
aaattcgacagcttctttaagcagctctactcaatttcacttgcatctagcaatgaatac
atctgcaaggactttttcctttacatggagtgccatcagtttggcttatttgccacatca
actgcacaaagcaacgattcaagtgccactgagggtgctattcatggggtaccatcaatt
gagaaaattactttctatcttgtcaggctagacgatggcgcaatactagatgagaaagct
ttccgcaatgattttatcaatctggctcatagtattggagcttacttgtatgaggacctg
ctatgcattgtctctcttcgatatcaaacaattcatgtcctacagatacgagattcaggc
aaccttgttgaagtacgcaaaattggtgcattttgccaggaagatgatgagctatttctc
cattcacatggtcaggctgcacgaggtgtttcttttcttcctggcatcaagcaacggttg
ttgtcatttatttttcgcaagacatggaatgaggaatctgatcagaccttgagagtccag
catctgaagaagaagttctattttcactttcaagactatgttgatcttatcatatggaag
gtgcagtttttggatcgtcatcacctatttatcaagtttggtagtgtggatggaggggtt
tctcgcagcactgaacagaattcagcattctttgctgtgtacaacatggagacgacagat
attgtttcactctatcagaattcttcggaggagctctattcattgtttgaatatttttat
gaccattttcacacaaatccacaaaattcatcgcatggaaattttatctcgtcacattcc
aataatgttcatgctctcgatcaacttcggacaattaaaaataaagcaaacagcacctca
cagcagtttgtgaaaaagatgatggcgtcactaccttacacttgtcaatcacaaagtcct
tcgccatactttgacctatcattgtttcggtatgatgagaagctgatttcagcgattgat
cggcacagacactgtacagagcatccaataaaatttatatcagtgaaacagccaaatgtt
gtcaaattcaagataaaaccaggttcagattctggtgcttctgacagcagggcaaaaaga
atatcttccttcttgtttcacccatttttccctctcgcactttctattcagcagacatat
atgcagccaactgttgtcaatttacatttcaggagatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329118
Entry
4329118           CDS       T01015                                 
Name
(RefSeq) DNA excision repair protein ERCC-8 isoform X1
  KO
K10570  DNA excision repair protein ERCC-8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4329118
  09124 Replication and repair
   03420 Nucleotide excision repair
    4329118
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4329118
   03400 DNA repair and recombination proteins [BR:osa03400]
    4329118
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     4329118
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      4329118
SSDB
Motif
Pfam: WD40 NBCH_WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 4329118
NCBI-ProteinID: XP_015627154
UniProt: Q6Z0X1
LinkDB
Position
2:12052015..12057609
AA seq 453 aa
MWCEAVRRRERGELGARRFETAARARRTASLALSNRKEFTTPHNGAVNSLQVDLIERRYL
LSGASDGSAAIFDVQNAIEYEAGFIAKHRSILLVDKQHENGHKFAVSMAVWYPVDTGLFV
TASFDQYVKVWDTNSTQVVMDFKMPGKVYSAAMSPIATTHMLIATGSADVQVRLCDIASG
AFTHTLSGHRDGIMSLEWSTSSEWILMSGGCDGAIRFWDIRRAGCFLVLDQSRSQLGRRP
PFLEGTSDKDPLNSLQPSSSSKIYSAQQRTGKSKKQSHKLHKSQIPGHGHIQQRLHPGLS
SSQNRATAHYGAVTGLRTTTDGMYLLSSGSDSRLRLWDIDSGCNTLVNFEAMRLQTSKPL
QLAVTEDPSLVFIPCMASIKAYNLWSGMTFQTFRGHYEPVNCCYYSAQEQELYTGSNDRQ
ILVWSPSTPAFTEMEDDGKRQMDFVVDEDNWSD
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgtggtgtgaggcggtgaggcggagggaacgcggggagcttggggcacggcgcttcgag
accgccgcccgggcgcgccgcaccgcctcactcgcactctccaaccgcaaggagttcacc
accccgcacaacggcgccgtcaactctctccaggttgatttgatagagcggcggtacctg
ctctcgggcgcatcggatggatcagccgctatatttgatgtgcagaatgcgatcgaatac
gaagctgggttcattgccaagcataggagcattctccttgtggacaagcagcatgaaaat
ggccacaagttcgcggtatctatggccgtatggtatcctgtggacactgggctgtttgtg
acagcttcttttgatcagtatgtcaaagtgtgggatactaattcgactcaagtcgtaatg
gattttaagatgcctggaaaagtgtacagtgcagcaatgtccccaattgcaacaacacat
atgctgatcgctactggaagtgcagatgttcaggtccgtttatgtgatattgcttctgga
gcctttacccacacgttgtctggtcatcgtgatggtatcatgtctttggagtggtctact
tcaagtgagtggattttgatgagcggtggttgtgatggagcaatacgattttgggacata
agacgagctggatgctttcttgttcttgatcaatcacggtctcaactaggaaggcggcct
ccttttcttgagggcacctcagataaggatcctttgaactctttacaaccttcatcttct
tcaaagatttactctgcacagcagaggacaggcaagagtaagaaacagtcacacaaattg
cacaaaagtcaaatccctggacatggacatatccaacagagattgcaccctggtttgtct
tctagtcaaaatcgtgcaacggcgcattatggtgctgttacgggattaagaacaactaca
gatgggatgtaccttcttagctcaggttctgattctcgcttaagactttgggatattgat
tcaggctgtaatactttggtcaattttgaagctatgcgattacagactagcaaaccacta
caattagctgtcactgaggatccatcacttgtattcatcccatgcatggcaagcattaag
gcgtacaatttatggtctggtatgacatttcaaacattccgtgggcactatgaacctgtt
aattgctgctactatagtgcacaagaacaagagctttatactggcagcaatgacaggcaa
attcttgtgtggtctccatcaactccagcatttactgaaatggaagatgatggcaagagg
caaatggattttgtagtcgatgaggataactggagcgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330868
Entry
4330868           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase COP1
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4330868
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4330868
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4330868
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4330868
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4330868
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     4330868
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 WD40_like zf-C3HC4_3 zf-RING_2 zf-C3HC4_4 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-RING_10 DUF1664
Other DBs
NCBI-GeneID: 4330868
NCBI-ProteinID: XP_015627602
UniProt: Q6ZHH4 Q0DX70
LinkDB
Position
2:complement(32528081..32533578)
AA seq 685 aa
MGDSTVAGALVPSVPKQEQAPSGDASTAALAVAGEGEEDAGARASAGGNGEAAADRDLLC
PICMAVIKDAFLTACGHSFCYMCIVTHLSHKSDCPCCGNYLTKAQLYPNFLLDKVLKKMS
ARQIAKTASPIDQFRYALQQGNDMAVKELDSLMTLIAEKKRHMEQQESETNMQILLVFLH
CLRKQKLEELNEIQTDLQYIKEDISAVERHRLELYRTKERYSMKLRMLLDEPAASKMWPS
PMDKPSGLFPPNSRGPLSTSNPGGLQNKKLDLKGQISHQGFQRRDVLTCSDPPSAPIQSG
NVIARKRRVQAQFNELQEYYLQRRRTGAQSRRLEERDIVTINKEGYHAGLEDFQSVLTTF
TRYSRLRVIAELRHGDLFHSANIVSSIEFDRDDELFATAGVSKRIKVFEFSTVVNEPSDV
HCPVVEMATRSKLSCLSWNKYSKNVIASSDYEGIVTVWDVQTRQSVMEYEEHEKRAWSVD
FSRTEPSMLVSGSDDCKVKVWCTKQEASAINIDMKANICSVKYNPGSSHYVAVGSADHHI
HYFDLRNPSAPVHVFGGHKKAVSYVKFLSTNELASASTDSTLRLWDVKENCPVRTFRGHK
NEKNFVGLSVNNEYIACGSETNEVFVYHKAISKPAANHRFVSSDLDDADDDPGSYFISAV
CWKSDSPTMLTANSQGTIKVLVLAP
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgggtgactcgacggtggccggcgcgctggtgccatcggtgccgaagcaggagcaggcg
ccgtcgggggacgcgtccacggcggcgttggcggtggcgggggagggggaggaggatgcg
ggggcgcgcgcctccgcggggggcaacggggaggccgcggccgacagggacctcctctgc
ccgatctgcatggcggtcatcaaggacgccttcctcaccgcctgcggccacagcttctgc
tacatgtgcatcgtcacgcatctcagccacaagagcgactgcccctgctgcggcaactac
ctcaccaaggcgcagctctaccccaacttcctcctcgacaaggtcttgaagaaaatgtca
gctcgccaaattgcgaagacagcatcaccgatagaccaatttcgatatgcactgcaacag
ggaaacgatatggcggttaaagaactagatagtcttatgactttgatcgcggagaagaag
cggcatatggaacagcaagagtcagaaacaaatatgcaaatattgctggtcttcttgcat
tgcctcagaaagcaaaagttggaagagctgaatgagattcaaactgacctacagtacatc
aaagaagatataagtgctgtggagagacataggttagaattatatcgaacaaaagaaagg
tactcaatgaagctccgcatgcttttggatgaacctgctgcatcaaagatgtggccctca
cctatggataaacctagtggtctctttcctcccaactctcggggaccacttagtacatca
aatccagggggtttacagaataagaagcttgacttgaaaggtcaaattagtcatcaagga
tttcaaaggagagatgttctcacttgctcggatcctcctagtgcccctattcaatcaggc
aacgttattgctcggaagaggcgagttcaagctcagtttaacgagcttcaagaatactat
cttcaaagacggcgtaccggagcacaatcacgtaggctggaggaaagagacatagtaaca
ataaataaagaaggttatcatgcaggacttgaggatttccagtctgtgctaacaacattc
acacgatatagtcgcttgcgtgtaattgcggagctaagacatggagatctgtttcactct
gcaaatatcgtatcaagtatcgaatttgaccgtgatgatgagctatttgctactgctgga
gtctcaaagcgcatcaaagtcttcgagttttctacagttgttaatgaaccatcagatgtg
cattgtccagttgttgaaatggctactagatctaaactcagctgccttagctggaacaag
tactcaaaaaatgttatagcaagcagcgactatgagggtatagtaactgtttgggatgtc
caaacccgccagagtgtgatggagtatgaagaacatgaaaagagagcatggagtgttgat
ttttctcgaacagaaccctcgatgctagtatctgggagtgatgattgcaaggtcaaagtg
tggtgcacaaagcaagaagcaagtgccatcaatattgatatgaaggccaatatttgctct
gtcaaatataatcctgggtcgagccactatgttgcagtgggttctgctgatcaccatatt
cattattttgatttgcgaaatccaagtgcgcctgtccatgtttttggtgggcacaagaaa
gctgtttcttatgtgaagttcctgtccaccaatgagcttgcgtctgcatcaactgatagc
acattacggttatgggatgtcaaagaaaattgccctgtaaggacattcagagggcacaag
aatgaaaagaactttgttgggctgtctgtaaataacgagtacattgcctgcgggagtgaa
acgaatgaggtttttgtttaccacaaggctatctcaaaacctgctgccaaccacagattt
gtatcatctgatctcgatgatgcagatgatgatcctggctcttattttattagcgcagtc
tgctggaagagcgatagccctaccatgttaactgctaacagtcagggcaccattaaagtt
cttgtacttgctccttga

DBGET integrated database retrieval system