KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280167
Entry
107280167         CDS       T01015                                 
Name
(RefSeq) probable serine acetyltransferase 1
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    107280167
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107280167
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     107280167
SSDB
Motif
Pfam: SATase_N Hexapep Hexapep_2
Other DBs
NCBI-GeneID: 107280167
NCBI-ProteinID: XP_015626737
UniProt: Q6ZHU3
LinkDB
Position
2
AA seq 298 aa
MTTAQPLQHEHDPSPPEPDADADDEEEESRVWSQIKAEARRDADGEPALASFVYATVLSH
PTLAGSLAFHLANKLASSSTLLSSTLLYDLFAAAHAARPDLRAAAAADLLAAGARDPACA
GRLSHCLLDYKGFLAVQAHRVAHALWAQGRRALALALQSRVAEVFAVDIHPAAAVGSGVL
LDHATGVVIGETAVVGDGVSILHHVTLGGTGEAVGDRHPKVGDGVLIGAGATILGNVRIG
AGAKIGAGSLVLADVPPGATAVGNPARLLLGGDQRGGAPAGESMDHASFMLEWSDYTI
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaccaccgcccagccactccagcacgagcatgacccgtccccgccggagccggacgcc
gacgccgacgacgaggaggaggagtcgcgggtgtggtcccagatcaaggccgaggcgcgc
cgcgacgccgacggcgagccggcgctggcgtcgttcgtgtacgccaccgtgctctcccac
cccaccctcgccggctccctcgccttccacctcgccaacaagctcgcctcctcctccacg
ctgctctcctccacgctcctctacgacctcttcgccgccgcccacgccgcgcgccccgac
ctccgcgccgccgccgccgccgacctcctagccgcgggcgcccgcgacccggcctgcgcg
ggccgcctctcccactgcctcctcgactacaagggcttcctcgccgtccaggcccaccgc
gtcgcgcacgcgctctgggcgcagggccgccgcgccctggcgctcgcgctccagtcccgc
gtcgccgaggtcttcgccgtcgacatccacccggccgccgccgtggggagcggcgtcctc
ctggaccacgccaccggggtggtcatcggcgagaccgccgtcgtcggcgacggcgtgtcc
atcctccaccacgtcacgctgggcgggaccggcgaggccgtcggcgaccggcaccccaag
gtcggcgacggcgtgctcatcggcgccggcgcgaccatcctcgggaacgtcaggatcggc
gccggcgccaagatcggggccgggtcgctggtgctcgccgacgtgccgccgggggccacg
gcggtggggaacccggcgaggctgctgctcggcggggaccagcgcggcggcgcgccggcc
ggtgaatccatggaccatgcctccttcatgctggagtggtcggattacaccatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324655
Entry
4324655           CDS       T01015                                 
Name
(RefSeq) probable serine acetyltransferase 1
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4324655
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4324655
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     4324655
SSDB
Motif
Pfam: SATase_N Hexapep Hexapep_2
Other DBs
NCBI-GeneID: 4324655
NCBI-ProteinID: XP_015648299
UniProt: Q8W0E4
LinkDB
Position
1:30042525..30043796
AA seq 303 aa
MTAGQPLRDDPQPRRHSPPALHPAVVPAYPPPESDADESWVWSQIKAEARRDADAEPALA
SFLYATVLSHPSLDRSLAFHLANKLCSSTLLSTLLYDLFVASLAAHPTLRAAVVADLLAA
RSRDPACVGFSHCLLNYKGFLAIQAQRVAHVLWAQDRRALALALQSRVAEVFAVDIHPAA
AIGKGVLLDHATGVVIGETAVIGDNVSILHHVTLGGTGKAVGDRHPKIGDGVLIGAGATI
LGNVRIGAGAKIGAGSLVLIDVPPRTTAVGNPARLLGGKKGDDMPGESMDHTSFIQQWSD
YSI
NT seq 912 nt   +upstreamnt  +downstreamnt
atgactgcgggccagcctctccgggacgatccccagccacgccggcacagcccgccggcg
ctccacccggccgtcgtgccggcgtacccgcccccggagtcggacgccgacgagtcgtgg
gtctggtcccagatcaaggccgaggcgcgccgcgacgccgacgccgagccggcgctcgcg
tcgttcctctacgccaccgtgctctcccacccctccctcgaccgctcgctcgccttccac
ctcgccaacaagctctgctcctccacgctgctctccacgctcctctacgacctcttcgtc
gcctccctcgccgcgcaccccaccctccgcgccgccgtcgtcgccgacctcctcgccgcg
cgctccagggaccccgcctgcgtcggcttctcccactgcctcctcaactacaagggcttc
ctcgccatccaggcccagcgcgtcgcgcacgtgctctgggcgcaggaccgccgcgccctc
gcgctcgcgctccagtcccgcgtcgccgaggtgttcgccgtcgacatccaccccgccgcc
gcgatcggcaagggcgtcctcctcgaccacgccacgggcgtcgtcatcggagagaccgcc
gtcatcggcgacaacgtctccatcctccaccacgtcacgctgggcgggacaggcaaggcc
gtgggcgaccggcaccccaagatcggcgacggcgtcctcattggcgccggcgcgacgatc
ctcggcaatgtcaggatcggcgccggggccaagatcggggccgggtcgctggtgctcatc
gacgtgccgccgaggaccacggcggtggggaatccggcgaggctgctcggcgggaagaag
ggcgacgacatgccgggtgaatccatggaccacacctccttcatccagcaatggtcggac
tacagcatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331528
Entry
4331528           CDS       T01015                                 
Name
(RefSeq) probable serine acetyltransferase 2
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4331528
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4331528
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     4331528
SSDB
Motif
Pfam: SATase_N Hexapep Hexapep_2
Other DBs
NCBI-GeneID: 4331528
NCBI-ProteinID: XP_015630173
UniProt: Q10S58
LinkDB
Position
3:complement(1892825..1897520)
AA seq 354 aa
MTSCGCLVLEKVEDHGGEAAGRGRGRLAQGGGGGGGGCGSCAGEWRSRSETMFPIYVMGS
SRASSAAAARGIVDAAGDPIWEAVKSEAKSEAEKEPILSSFLYASVLSHDCLERALSFVL
ANRLEDPTLLATQLIDIFNDVMMNNKDIRRSIRLDAQAFKDRDPACAQYSWALLYLKGYH
SVQSYRIAHVLWNQGRKVLALALQSRISEVFAVDIHPAARIGEGILLDHGTGLVIGETAI
VGNWVSLMQGVTLGGTGKENGDRHPKIGQGALLGAGATILGNINVGEGAMIAAGSLVLKD
VPPHSMAVGNPAKVVGYKDKEDPSLTMKHDARRDYFEHVAVSFSDDKANGSVVK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacgtcgtgcgggtgcctggtgctcgagaaggtggaggaccacggcggcgaggcggcg
gggagggggagagggaggctcgcgcagggtggcggcggcggcggcggtggctgcggatcg
tgcgcgggggagtggaggagccggtcggagaccatgttccccatctacgtgatggggagc
tcgcgggccagctccgccgcggcggcgcggggcatagtcgacgccgccggggaccccata
tgggaggccgtcaagtcggaggccaagtctgaggcagagaaggaacctattttaagtagc
ttcttgtacgccagcgtactatctcatgactgtctcgagagggcgttgagtttcgtcctt
gcaaacaggctcgaagatccaacattgcttgcaactcagttaatagacattttcaatgat
gttatgatgaacaacaaagatatacgccgttctattcgccttgatgctcaggcctttaaa
gacagagatcctgcctgtgcacaatacagttgggcattgttgtacctcaagggttaccat
tccgtgcaatcctataggatagctcatgtattatggaatcaaggtcgtaaagttctggca
ttggcactgcagagccgtatcagtgaggtttttgcagtggatatacacccagcggccaga
attggagagggaatattgttggatcatggaacgggtctagttattggtgaaactgccatt
gttggaaactgggtttcattaatgcagggtgttacacttggtggtactggcaaggaaaat
ggagatagacaccccaagattggtcagggggctcttcttggagctggtgctactatcctc
ggcaacataaacgtaggcgaaggtgccatgattgctgctggttcccttgttttaaaggat
gtacctccccacagtatggcagtaggaaaccctgcaaaggtagttgggtataaagataag
gaagacccttctttaactatgaaacatgatgccagaagagattattttgagcatgttgcc
gttagtttttcagatgacaaagctaatggaagtgttgtgaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331861
Entry
4331861           CDS       T01015                                 
Name
(RefSeq) probable serine acetyltransferase 3
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4331861
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4331861
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     4331861
SSDB
Motif
Pfam: SATase_N Hexapep Hexapep_2 Rap1a
Other DBs
NCBI-GeneID: 4331861
NCBI-ProteinID: XP_015629961
UniProt: Q0DUI1
LinkDB
Position
3:4464068..4465509
AA seq 301 aa
MAACVDKWPAAYPCRLPDKFYCALPDCTTTDRPVAPAPAASGSSGDYVWDALRAEAQDDA
DDEPLLRKFYHDLVLSRPSLESALASLLAAKLCIPGALPQDQLRDLLAGALAAHPEAGRA
ARADLAAARDRDPACAKMVHCFLYYRGFLALQAHRAAHALWSDNRRAPALLLQSRASEVF
GVDIHPGARIGGGILLDHATGVVIGETAVVGYGVSILHAVTLGGTGKESGDRHPKVGDGV
LIGAGASVLGNVHIGDGAEIGAGAIVLRDVADGTTAKPIIGKKAEPQRELPGVTMEQRWS
D
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcagcctgcgtcgataagtggccggcggcgtacccgtgccgcctgccggataagttc
tactgcgccttgccggactgcaccaccacggaccgtccggtggcgccggcgccggcggct
agcgggagcagcggcgactacgtgtgggacgcgctgcgcgccgaggcgcaggacgacgcg
gacgacgagccgctcctccgcaagttctaccacgacctcgtcctgtcgcggccgtcgctg
gagtccgcgctcgcctcgctgctggcggccaagctctgcatccccggcgcgctgccgcag
gaccagctccgggacctcctcgccggcgcgctcgccgcgcacccggaggccgggcgcgcc
gcgcgcgccgacctcgccgcggcgcgcgaccgcgacccggcctgcgccaagatggtccac
tgcttcctctactacaggggcttcctggcactgcaggcccaccgcgcggcgcacgcgctc
tggtccgacaaccgcagggcgccggccctccttctccagagccgcgcctccgaggtgttc
ggcgtcgacatccaccccggggcgcgcattggcggcggcatcctgctcgaccacgccacg
ggcgtcgtcatcggcgagacggccgtcgtcggctacggcgtgtccatcctgcacgccgtg
acgctgggcggcacggggaaggagtccggcgaccggcaccccaaggtcggggacggtgtg
ctgatcggcgccggggcgagcgtgctcggcaatgtgcacattggcgacggagcggagatc
ggagccggtgcaatcgtgctacgggacgtggcggacggaaccacggccaagccgatcatc
ggcaagaaggcggagccgcaacgagagcttcccggggtaaccatggagcagagatggtcg
gattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331941
Entry
4331941           CDS       T01015                                 
Name
(RefSeq) probable serine acetyltransferase 4
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4331941
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4331941
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     4331941
SSDB
Motif
Pfam: SATase_N Hexapep Hexapep_2 MspA Rap1a
Other DBs
NCBI-GeneID: 4331941
NCBI-ProteinID: XP_015631062
UniProt: Q10QH1
LinkDB
Position
3:complement(5063801..5065259)
AA seq 315 aa
MAACVDKWPPAAYLCRLPEKFYCVLPDCTATDRPVVTASAAPAPAASGSSGDYVWDVLRA
EAQDDADDEPLLRKFYHDLVLSRPSLESALASLLAAKLCIPGALPQDQLRDLLAGALAAH
PEAGRAARADLVAARDRDPACAKMVHCFLYYKGFLALQAHRAAHALWSDNRRAPALLLQS
RASEVFGVDIHPGARIGCGILLDHATGVVIGETAVVGYDVSILHGVTLGGTGKESGDRHP
KVGDGVLIGAGASVLGNVHIGDGAKIGAGAVVLRDVADGTTAVGNPAKPIIGKKAAPQRR
PEELPGVTMEQRWSD
NT seq 948 nt   +upstreamnt  +downstreamnt
atggcagcctgcgtcgacaagtggccgccggcggcgtacctgtgccgcctgccggagaag
ttctactgcgtcttgccggactgcaccgctacggaccgtccggtggtcaccgcatcggcg
gcgccggcgccggccgctagcgggagcagcggcgactacgtgtgggacgtgctgcgcgcc
gaggcgcaggacgacgcggacgacgagccgctcctccgcaagttctaccacgacctcgtc
ctgtcgcggccgtcgctggagtccgcgctcgcctcgctgctggcggccaagctctgcatc
cccggcgcgctgccgcaggaccagctccgggacctcctcgccggcgcgctcgccgcgcac
ccggaggccgggcgcgccgcgcgcgccgacctcgtcgcggcgcgcgaccgcgacccggcc
tgcgccaagatggtccactgcttcctctactacaagggcttcctggcactgcaggcccac
cgcgcggcgcacgcgctctggtccgacaaccgcagggcgccggctctcctcctccagagc
cgcgcctccgaggtgttcggcgtcgacatccaccccggtgcgcgcattggctgcggcatc
ctgctcgaccacgccacgggcgtcgtcatcggcgagacggccgtcgtcggctacgacgtg
tccatcctgcacggggtgacgctgggcggcacggggaaggagtccggcgaccggcacccc
aaggtcggggacggtgtgctgatcggcgccggggcgagcgtgctcggcaatgtgcacatt
ggcgacggagcgaagatcggagccggcgcagtcgtgctacgggacgtggcggacggaacc
acggccgtcgggaacccagcgaagccgatcatcggcaagaaggcggcgccgcaacggcgg
ccggaagagcttcccggggtaaccatggagcagagatggtcggattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339425
Entry
4339425           CDS       T01015                                 
Name
(RefSeq) probable serine acetyltransferase 5
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4339425
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4339425
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     4339425
SSDB
Motif
Pfam: SATase_N Hexapep Hexapep_2
Other DBs
NCBI-GeneID: 4339425
NCBI-ProteinID: XP_015639006
UniProt: Q0DGG8
LinkDB
Position
5:complement(26480058..26481466)
AA seq 340 aa
MLVVVARKSSSSARVAAHQTRSHRAAMPAGQPHAHEPDGGGASHRRPQSPPSLPAEVVPA
FAPPESEDEESWVWSQIKAEARRDADAEPALASFLYATVLSHPSLPRSISFHLANKLCSS
TLLSTLLYDLFLASFTAHPSLRAAVVADLLAARSRDPACVGFSQCLLNFKGFLAIQAHRV
SHVLWAQQRRPLALALQSRVADVFAVDIHPAAVVGKGILLDHATGVVIGETAVVGDNVSI
LHHVTLGGTGKAVGDRHPKIGDGVLIGAGATILGNVKIGAGAKIGAGSVVLIDVPARNTA
VGNPARLIGRKNGEVEKDEDMPGESMDHTSFIRQWSDYTI
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgctagtggtagtggcccgcaaatcctcctcctccgctcgcgtcgccgcccaccaaacc
cgatcccaccgcgccgcgatgccggccggccagccgcacgcgcacgagcccgacggcggc
ggcgcgagccaccgccggccccagtcgccgccgtcgctccccgcggaggtggtcccggcg
ttcgcgccgccggagtcggaggacgaggagtcctgggtctggtcccagatcaaggccgag
gcgcgccgcgacgccgacgccgagccggcgctcgcgtccttcctctacgccaccgtgctc
tcccacccctccctcccgcgctccatctccttccacctcgccaacaagctctgctcctcc
accctcctctccacgctcctctacgacctcttcctggcttccttcaccgcgcacccctcc
ctccgcgccgccgtcgtcgccgacctcctcgccgcccgctcccgcgacccggcctgcgtc
ggcttctcccagtgcctcctcaacttcaagggcttcctcgccatccaggcgcaccgcgtg
tcgcacgtcctctgggcgcagcagcgacgcccccttgccctcgccctccagtcccgcgtc
gccgacgtcttcgccgtcgacatccaccccgcggccgtcgtcggcaagggcatcctcctc
gaccacgccaccggcgtcgtcatcggcgagaccgccgtcgtcggcgacaacgtctccatc
ctccaccacgttacactgggtggcacaggcaaggctgtcggtgaccggcaccccaagatt
ggggatggtgttctgattggcgccggggcgacgattcttggcaacgtcaagattggagcc
ggggccaagattggtgccgggtcagtggtgctgatagatgtgccggcgaggaacacggcg
gtggggaatccagccaggttgattggcaggaagaacggtgaggttgagaaggatgaggac
atgcccggggaatccatggatcacacatccttcattcgacagtggtcggactacaccatt
tga

DBGET integrated database retrieval system