KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280428
Entry
107280428         CDS       T01015                                 
Name
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107280428
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    107280428
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    107280428
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     107280428
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   107280428
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N DUF6790
Other DBs
NCBI-GeneID: 107280428
NCBI-ProteinID: XP_015630630
LinkDB
Position
3:complement(16372176..16379078)
AA seq 498 aa
MARVVAPPLCTWLVAACLSAACGDAAGKRSSCAGNGGAMFRLVAPRPPPRRPCRGGRGAR
SGGIPMAIALHPERGAVESKKPDIKQRRVVVTGMGVVTPLGHDPDEFYNNLLQGVSGISE
IEAFDCSKYPTRIAGEIKSFSTDGWVAPKLAKRMDKFMLYLITAGKKALENGGITEEVMN
ELDKSRCGVLVGSAMGGMKIFSDAIEALRVSYKKMNPFCVPFATTNMGSAILAMDLGWMG
PNYSISTACATSNFCILNAANHIRRGETDVMLCGGSDAPIIPIGLGGFVACRALSQRNND
PAKASRPWDVDRDGFVMGEGAGVLLLEELEHAKQRGAQIYAEFLGGSFTCDAYHMTEPHP
EGRGVILCIENALADAGVAKEDINYVNAHATSTQMGDLKEFEALNRCFGQNPQLRVNSTK
SMTGHLLGAAGGIEAVAAIQAIRTGWVHPNINLDNPEKNVDVSILVGSQKERCDVKVALS
NSFGFGGHNSSVLFAPFK
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcccgggttgttgcgccgccgctctgcacctggctcgtcgccgcctgcctctcggcg
gcctgcggcgacgccgccggcaagagaagcagctgcgcaggcaacggcggcgccatgttt
cggctcgtggcgccgcggccgcccccccggcgcccgtgccgaggcggcaggggcgcgcgc
tctggtggaatacccatggctatagctttgcatcctgaaaggggagctgtggaaagcaag
aagcctgatattaaacaacggagagtggtcgtcactggcatgggtgtcgtgacaccgtta
ggccatgatcctgatgagttttataacaaccttctacagggtgttagtggaataagcgag
atagaagcatttgactgctccaagtaccccacgagaattgcaggagaaatcaagtccttc
tcaactgatggctgggtagcaccaaaattagctaagagaatggacaagttcatgctatat
ttgataactgctgggaaaaaagcattggaaaacggtggaatcaccgaagaagtcatgaat
gagttggacaaatcgagatgtggagttcttgttggttctgctatgggtggcatgaagatt
tttagtgatgcaattgaagcattgagggtatcctacaagaagatgaacccattctgtgta
ccttttgcgactacaaacatgggttctgcaatacttgcgatggatctgggctggatgggc
ccaaactattctatctctactgcttgcgccaccagtaatttctgcatactaaatgcagct
aatcatatcagaagaggggaaactgatgtgatgctttgtggtggttctgatgcaccaatt
attccgattggattgggtggttttgtggcttgcagagctctttcacagagaaataatgat
ccagcaaaagcttctcggccgtgggatgtggatcgtgatggatttgtaatgggagaaggg
gctggtgtgcttcttctggaagaacttgagcatgctaagcaaagaggtgcacaaatatat
gctgagtttctaggaggaagcttcacatgtgatgcataccacatgacagagccacatcct
gaaggtagaggggttatcctttgtattgaaaatgcactagcagatgcaggagtagcaaag
gaagacattaattatgtaaatgcccatgcaacatcgacgcagatgggtgatttgaaggaa
tttgaagctctcaaccgctgttttggtcagaaccctcagcttagagtaaactcaacaaag
tcaatgacgggtcatctgctaggagctgcaggtggaatagaagctgtggctgctatacaa
gctataaggactggttgggtccacccaaatatcaatttagacaacccggagaaaaatgtg
gatgtcagcattctagtgggatcacaaaaagagagatgtgatgtaaaggtggcgttgtcg
aactcgttcggattcggtgggcataactcatcggttttgtttgcacccttcaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328619
Entry
4328619           CDS       T01015                                 
Name
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4328619
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4328619
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4328619
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     4328619
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4328619
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N Thiolase_C
Other DBs
NCBI-GeneID: 4328619
NCBI-ProteinID: XP_015623631
LinkDB
Position
2:complement(5422089..5426259)
AA seq 470 aa
MGCLRRALRLGLRRGLSSSSAAPAAAEQAELPPPRPSAGRRVVVTGLGAVTPLGRGVGPT
WDRLVAGGCAVRALAAEDLRLPGGADAGRTLEQLPSRVAAPVPRGKGDAEFDEEAWTKDN
KSISGFIAYALCAADEALRDANWLPSEDEKKERTGVSIGGGIGSISDILDASQMILENRL
RRLSPYFIPKILINMASGHVSMRYGFQGPNHAAVTACATGAHSIGDATRMIQFGDADVMV
AGGTESSIDALSIAGFSRLRALSTKYNSLPQAASRPFDCGRDGFVIGEGCGVMVLEALDH
AKERGAKIYAEVRGYGMSGDAHHITQPQNDGRGATLAMKRALDQSGLQADQIDYLNAHAT
STPLGDAVEANAIKSVFGDHATSGGLALSSTKGAIGHLLGAAGSVEAIFTVLAIHHGIAP
PTLNLEKPDTLFEGAFMPLSSPKKMPIRAAISNSFGFGGTNTSLLFSCPP
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgggctgcctccgccgcgcgctccgcctcggcctacgccgtgggctctcctcctcctcg
gcggctccggcggccgcggagcaggctgagctccccccgccgcgcccctccgcggggcgc
cgcgtggtggtcacggggctcggggccgtcacccctctcggccgcggcgtggggcccacc
tgggaccgcctcgtggccggcggctgcgcggtgcgcgcgctcgccgccgaggacctgcgc
ctcccggggggagccgacgcggggaggacgctggagcagctcccgtccagggtcgccgcc
cccgtgccgcgcgggaagggcgacgccgagttcgacgaggaggcttggactaaggacaat
aaatctatatccggatttatagcctatgctctatgtgcagctgatgaggctttaagagat
gcaaattggttgccttcagaagatgagaagaaggaaagaacgggagtctcaatcggtgga
gggattggaagcatctcagacattttagatgcatcgcagatgatacttgaaaatcgtcta
cgtcgcctcagtccatatttcattcccaagattttgattaacatggcatccggtcatgtc
agcatgagatatggtttccagggtccaaaccatgctgctgtgacagcttgtgccacaggt
gcccactctattggtgatgctacacggatgattcaatttggagacgcggatgtaatggtg
gctggtggaacagagtccagcattgatgctttgtctatagctggattttctagattaaga
gcattgtctacaaaatataactctcttcctcaagcggcttccaggccatttgattgtggt
agagatggatttgtgattggtgaaggttgtggagttatggtgttggaggcacttgatcat
gcaaaagaacgtggggcaaaaatttatgcagaagtgagaggctatggaatgtctggtgac
gcacaccacataactcagccacaaaatgatggtagaggtgctaccttagccatgaaacga
gctttggatcagtcaggccttcaggcagatcaaatcgattatctgaatgcacatgcgacc
tcaactcctcttggtgatgctgtagaggctaatgcaatcaaatctgtctttggtgaccat
gcaacatcaggtggtcttgcattgtcctcaacaaagggagcaattggtcatctgcttggg
gcagctgggtcagtggaagcaatcttcaccgtattagccatccaccatggcatcgctcca
ccgacacttaatctagaaaaaccagacacgctgtttgaaggcgcgttcatgcctctatct
tccccaaagaagatgcctatccgagctgccatctcgaattcctttgggtttggtggaacc
aacacgtcgctgctgttctcgtgccctccttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335962
Entry
4335962           CDS       T01015                                 
Name
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4335962
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4335962
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4335962
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     4335962
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4335962
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Other DBs
NCBI-GeneID: 4335962
NCBI-ProteinID: XP_015634289
UniProt: B7F6I0
LinkDB
Position
4:complement(22216911..22221338)
AA seq 462 aa
MQAHAHTLGLRISPPPPAPPRRRARPRRRAVRVAAAASAPRRETDPRKRVVITGMGLVSV
FGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFSSEGYIDGKNDRRLDDCLR
YCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLTVFSDGVQNLIEKGYKKIS
PFFIPYAITNMGSALLAMDAGFMGPNYSISTACATSNYCFYAAANHIRRGEADVIVAGGT
EAAIIPIGLGGFVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLEHAMKRD
APIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNYINAHATSTLAG
DLAEVRAIKQVFKNPSDIKINSTKSMIGHCLGAAGGLEAIAVVKAITTGWVHPTINQFNP
EPEVDFDTVANEKQQHEVNVAISNSFGFGGHNSVVVFAPFKP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgcaggcgcacgcccacacgctcgggctccgcatctccccgccgccgcctgcgccgccg
cggcgccgcgctcgcccgcgccggcgcgcagtccgtgtcgccgcggcggcgtcggcgccg
cggcgggagacggacccgaggaagcgggtggtgatcacggggatggggctggtgtccgtg
ttcgggaacgaggtggacgccttctacgagcggctgctcgccggggagagcggggtcggc
gccatcgaccgcttcgacgccggcggcttccccacgaggttcgccggccagatacgcggg
ttctcctcggaggggtacatcgacggcaagaacgaccggaggctcgacgactgcctccgc
tactgcatcgtcagcggcaagaaggcgctcgagaacgccggcctcggcaagggctccgat
ggccacaccaagcttgacaaagtccgggctggtgttcttgtgggaactggcatgggtggc
ctcactgtgttttccgatggtgttcaaaaccttattgagaagggatacaagaaaatttcg
cctttctttatcccatacgctataactaacatgggctcggcattgctagcaatggatgct
ggttttatgggtccaaactactcaatttcaacagcttgtgcgacctccaactactgcttc
tatgctgctgccaaccatatacgtcggggtgaggctgatgttatcgttgctggtggtact
gaagctgcaattattccaattggccttggaggttttgtggcctgtagagcactatcgcag
aggaacgatgacccagaaactgcatctaggccatgggacaaagagcgagatggttttgtt
atgggcgaaggtgctggtgtactggtcatggagagcctggagcatgcgatgaagcgggat
gcaccaataattgctgaatatttgggaggtgcagtaaactgtgatgcttaccatatgact
gatcctaggtcagatggactgggtgtatcgtcctgtattactcagagccttgaagatgca
ggtgttgcgccagaggaggtaaattacatcaatgcacatgcaacttcaactcttgctggt
gacttggctgaagtaagagccattaagcaagtcttcaagaatccatctgatattaaaatc
aattcaacgaagtctatgataggccattgcctaggtgccgctggtgggttagaagctatt
gccgttgtcaaagccataactactggatgggtgcatcctactattaaccaatttaacccc
gagcctgaagttgattttgatacagtagccaacgagaagcagcagcacgaagtgaatgtt
gctatctctaattcatttggatttggaggtcacaattcagtggtagtatttgcgccattc
aagccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340392
Entry
4340392           CDS       T01015                                 
Name
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4340392
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4340392
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4340392
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     4340392
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4340392
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Other DBs
NCBI-GeneID: 4340392
NCBI-ProteinID: XP_015640876
UniProt: Q69YA2 A0A0P0WU44
LinkDB
Position
6:complement(4897195..4900574)
AA seq 465 aa
MQSLLLPTFAAASAAPPRRGRVPPAGRASVSVRASASAAAVAPRRETDPRKRVVITGMGL
VSVFGNDVDAYYDRLLAGESGIGPIDRFDASNFPTRFAGQIRGFSSEGYIDGKNDRRLDD
CLRYCIVSGKKALESAGLALGSKSMDKIEKTRAGVLVGTGMGGLTVFSDGVQNLIEKGHR
KITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYCFYAAANHIRRGEADVMIA
GGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDQDRDGFVMGEGAGVLVMESLEHAM
KRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLADAGVAPEEVNYINAHATST
LAGDLAEVNAIRQVFKDPSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPSINQ
FNPEPAVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPFKP
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgcagagcctcctcctccccaccttcgccgcggcctccgccgcccccccgcggaggggg
cgcgtgcctcccgccggtcgcgcctcggtctccgtgcgcgcgtccgcgtccgcggcggcg
gtggcgccgaggagggagacggatccgaggaagagggtggtgatcacggggatggggctg
gtgtccgtgttcgggaacgacgtcgacgcctactacgaccgcctcctcgccggggagagc
gggattggccccatcgaccgcttcgacgcctccaacttccccacccgcttcgccggccag
atccggggcttctcctccgagggctacatcgacggcaagaacgaccgccgcctcgacgac
tgcctccgctactgcatcgtcagcggcaagaaggccctcgagtccgccggcctcgccctc
ggctccaaatccatggacaagattgaaaagactcgggctggtgtacttgtgggcaccggt
atgggtggtcttacagtgttctctgatggtgttcagaatcttattgagaaggggcacaga
aagataactccattcttcattccgtatgccataacaaacatgggatctgcccttcttgga
atggacattggtttcatgggtccaaactactccatctcaactgcatgtgctacctcgaac
tactgtttctatgctgcagcaaaccatattcgcagaggcgaagccgatgtgatgattgct
ggtggcactgaagccgcaattattccgattggtgtcggtgggtttgtcgcgtgtagagca
ctttcacagaggaacgatgaccccaaaacagcatcaagaccttgggaccaagaccgtgat
ggttttgtcatgggtgaaggagctggagtactggtcatggagagcctagaacatgcaatg
aagcgtgacgcaccaataattgcggagtatttaggaggtgccgtgaactgtgatgcttac
catatgactgacccgagatctgatggccttggtgtttcgtcttgcattaagcaaagtctt
gcagatgctggcgttgcaccggaggaggtcaactacataaatgctcatgcaacgtccacc
ctagctggtgatctggcagaggtgaacgccattaggcaagtcttcaaggatccatcagag
attaaaataaatgcaaccaagtccatgattggacattgccttggtgcggctggtggcttg
gaagccattgcaactgttaaagctataaccactggatgggtccatccaagcataaaccag
tttaacccggagccagctgttgaatttgacacggtacctaatgtaaaaaagcaacatgaa
gtgaatgttggtatctcgaattcctttggatttggtggacacaattcagttgtagtattt
gcaccatttaagccttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343906
Entry
4343906           CDS       T01015                                 
Name
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4343906
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4343906
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4343906
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     4343906
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4343906
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N DUF6790
Other DBs
NCBI-GeneID: 4343906
NCBI-ProteinID: XP_015644677
UniProt: Q8H3I6 Q0D4N5
LinkDB
Position
7:complement(25392932..25398616)
AA seq 507 aa
MAAVAVPPLSAWLVAARSSTQAECGGADEHHHHHHQQQHQCCVGGGSSTVMFGPRRRRFL
GGGARRRGAARSGMAMAVALQPERRTVEKKPDVKQRRVVITGMGVVTPLGHDPDVFYNNL
LDGVSGISEIERFDCSTFPTRIAGEIKSFSTDGWVAPKLARRMDKFMLYLITAGKKALEH
GGLTEELRNELDKTRCGVLIGSAMGGMKVFNDAIEALRVSYKKMNPFCVPFATTNMGSAI
LAMDLGWMGPNYSISTACATSNFCILNAANHIRRGEADVMLCGGSDAPLIPIGLGGFVAC
RALSQRNSDPTKASRPWDVDRDGFVMGEGAGVLVLEELEHAKQRGAKIYAEFLGGSFTCD
AYHMTEPHPEGRGIILCIEKALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQN
PQLRVNSTKSMTGHLIGAAGGIEAVAAIQAIRTGWVHPNLNLENPEKIVDVGVLVGSQKE
RCKVNVALSNSFGFGGHNSSILFAPFK
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcggccgtggcggtgcccccgctctccgcgtggctcgtcgccgcgcgctcctcgacg
caggcggaatgcggcggcgccgacgagcaccaccaccaccaccatcagcagcagcaccag
tgctgcgtcggcggcgggtccagcacggtgatgttcggcccgcgccgccgccgcttcctc
ggcggcggcgcgcggcggcgcggcgcggcgcgctctggaatggccatggctgttgccctg
cagcctgaaaggagaactgttgaaaagaaacctgatgttaaacaaagaagggtggttatc
actggcatgggtgtagtaacaccgttgggccatgatcctgatgtgttttacaacaacctt
ctggatggtgttagtggaataagcgagatagaaaggttcgactgctccacgtttccgacg
agaattgcaggagagataaaatccttttctactgatggttgggttgctcctaagctagct
aggcgaatggacaagttcatgctatatttgataactgctggaaagaaggcgttggaacat
ggtggtctcactgaagaactcaggaatgaattggataaaaccagatgcggtgttctcatt
ggttctgcaatgggtggcatgaaggtttttaatgatgcgattgaagcattgagggtctcc
tacaagaaaatgaacccattttgtgtcccttttgcaactacaaatatgggctctgcaata
cttgcaatggatctgggctggatggggccgaactattctatttccaccgcgtgtgctacc
agtaatttctgtatcctcaatgcagcaaaccatatcagaagaggggaagctgatgttatg
ctctgtggtggttctgatgcaccactcatcccaattggattaggaggttttgtggcttgc
agagcactttcacagagaaacagtgacccaactaaagcttcccggccatgggatgtggac
cgtgacggttttgttatgggggaaggggcaggtgttcttgtgttggaagaacttgaacac
gccaagcaaagaggtgcaaaaatatatgctgaatttctaggtggaagcttcacgtgtgat
gcataccacatgactgagccacatcctgaaggaagagggattattctttgtatagaaaag
gcactggctgattcaggagtagcaagggaagaaatcaactatgtcaatgctcacgcaacg
tctacacagtcaggtgatttgaaggagtatgaagctattgtccgctgctttggccagaac
cctcagctaagggtgaactcaacaaaatcaatgactggacatctaataggtgcagctggt
ggaatagaagctgttgctgctattcaagctataagaactggctgggtccatccgaatctg
aatttggagaacccagagaaaatagtggatgtgggcgtgctggtcgggtcgcagaaggag
agatgcaaagtgaatgtggcactgtcaaactcatttggatttggtgggcacaactcatca
attctgtttgcacccttcaagtga

DBGET integrated database retrieval system