KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280467
Entry
107280467         CDS       T01015                                 
Name
(RefSeq) signal peptidase complex catalytic subunit SEC11A-like
  KO
K13280  signal peptidase I [EC:3.4.21.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107280467
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    107280467
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     107280467
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   107280467
SSDB
Motif
Pfam: Peptidase_S24 Peptidase_S26
Other DBs
NCBI-GeneID: 107280467
NCBI-ProteinID: XP_015632296
LinkDB
Position
3:2455979..2464790
AA seq 175 aa
MDRERRRLRGRGGNNNHPRRVLADVVIRFDPTWLVTILLLSLLLLGKATGTTATVVVSGS
MEPGIRRGDMLIVRERRNDGDGDDNIRAGDIVLFSTELHPVPIVHRVIELHERHDGGARQ
MLTKGDNNGVTDRSSLYTGQWLHDHHILGRAVGFLPYLGWPRCLIQDFVLDKLNL
NT seq 528 nt   +upstreamnt  +downstreamnt
atggatcgcgagcggcggcggctgcgcggccgcggcgggaacaacaaccacccacggcgc
gtcctggccgacgtcgtcatccgcttcgaccccacatggctggtgacgatcctcctgttg
tcgcttctgctactggggaaggcgacggggaccacggcgacggtggtcgtctccggcagc
atggagccagggatccggcggggcgacatgctcatcgtacgggagcggcgcaacgacggc
gacggcgacgacaacatccgcgccggggacatcgtcctcttcagcaccgaactccacccc
gtccccatcgttcatcgcgtcatcgagctccacgagcgacacgacggcggcgcgaggcag
atgctaacgaaaggtgacaacaatggtgtcaccgatagaagctccctctacacggggcag
tggctgcacgatcaccatattttgggaagagcagtcgggtttttgccttatcttggttgg
ccgcgttgcttgatccaagattttgtacttgacaaactgaatttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331226
Entry
4331226           CDS       T01015                                 
Name
(RefSeq) signal peptidase complex catalytic subunit SEC11A isoform X1
  KO
K13280  signal peptidase I [EC:3.4.21.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4331226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4331226
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     4331226
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   4331226
SSDB
Motif
Pfam: Peptidase_S24 Peptidase_S26
Other DBs
NCBI-GeneID: 4331226
NCBI-ProteinID: XP_015625344
LinkDB
Position
2:complement(35572387..35578223)
AA seq 289 aa
MQIRHALVHLITLGMVISSALMIWKGLIIMTGSESPLVVVLSESMELGFERGDILFLQMS
KHPIRTGDIVVFNDGREIPIVHRVIEVHERRDNAQVDFLTKGDNNPMDDRILYTHGQLWL
QQHHIMGRAIGYLPKAGWVTLVMTEKPVIKLVQQIGRNMFLTLRELEESIGFWKAKKTSS
ILVFRGVLISYSYSIVMSRDFAYSSARTVGFRMLSKTCLTMRDAYGTSLSFYNFLVYHKF
AYQTIKYSVNIFILKKFKINLFFKFIASTLIMFFFSFCVRQKAKLPSID
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcagattcgccacgccctcgtccacctcattaccctggggatggttatcagctcggca
ttgatgatatggaagggattgattatcatgacagggagtgagtcgccactagttgtggtt
ctatctgaaagcatggagcttggatttgaaaggggggatatcctgtttttgcaaatgagc
aaacaccctatacgaacaggagatatagttgttttcaatgatggccgtgaaattccaatc
gtccatcgcgttattgaggttcacgaacgacgggataatgcacaagttgatttcctcaca
aaaggtgacaacaatcctatggacgaccgaattctttacacacatgggcagctttggctt
cagcaacatcacatcatgggacgggccatagggtatctacccaaagctgggtgggtgaca
ttggtgatgactgagaaaccagttattaagctagtacaacaaattggtcggaacatgttt
ctaacactcagggaattggaggaaagcattggtttttggaaggctaaaaaaaccagcagc
atacttgtgtttagaggagtattaattagctactcctacagtattgtaatgtcgagggat
tttgcatattcttccgcccggacggttgggttcagaatgctatccaaaacttgtttaaca
atgcgggatgcatacggaacctcacttagcttttacaactttctcgtttatcataaattc
gcttaccaaactattaaatattctgtaaatatttttatattaaaaaaatttaaaataaac
ttatttttcaagtttatagctagtacactaatcatgttttttttttcattttgtgtacgg
caaaaagcaaagcttccgagcatagactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338334
Entry
4338334           CDS       T01015                                 
Name
(RefSeq) signal peptidase complex catalytic subunit SEC11A
  KO
K13280  signal peptidase I [EC:3.4.21.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4338334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4338334
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     4338334
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   4338334
SSDB
Motif
Pfam: Peptidase_S24 Peptidase_S26
Other DBs
NCBI-GeneID: 4338334
NCBI-ProteinID: XP_015637864
UniProt: B9FNQ6 Q0DJD8
LinkDB
Position
5:13282402..13286142
AA seq 180 aa
MGFIGDTVESIRSIQIRQVLAQIISLGMIVTSALIIWKGLMVATGSESPVVVVLSGSMEP
GFKRGDILFLHMSKDPIRTGEIVVFNIDGREIPIVHRVIKVHEREESAEVDILTKGDNNF
GDDRLLYAHGQLWLHQHHIMGRAVGFLPYVGWVTIIMTEKPFIKYLLIGALGLLVITSKE
NT seq 543 nt   +upstreamnt  +downstreamnt
atgggattcatcggcgatacggtggagtcgatccgctcgatacagatccgccaagtcctc
gcgcaaatcatcagcctcggtatgattgttacctcggcactgatcatatggaagggattg
atggttgcaacggggagcgagtccccagtggttgtggtcctttctggtagcatggagcct
ggatttaaaaggggcgatatcctttttctacacatgagcaaagatcctatccgcacagga
gagatagttgttttcaacattgatggccgtgaaattccaattgttcaccgtgtgattaag
gtccatgaacgcgaggaaagtgctgaagttgatatcctcacgaaaggtgataataatttt
ggggacgaccgtcttctttatgcacatgggcagctttggcttcaccaacatcacattatg
ggacgggctgtaggctttcttccatatgtcgggtgggttacaatcatcatgactgagaaa
ccatttataaagtacctgctcatcggcgctctgggcttgctggtcattacatcgaaagag
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340738
Entry
4340738           CDS       T01015                                 
Name
(RefSeq) signal peptidase complex catalytic subunit SEC11A
  KO
K13280  signal peptidase I [EC:3.4.21.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4340738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4340738
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     4340738
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   4340738
SSDB
Motif
Pfam: Peptidase_S24 Peptidase_S26
Other DBs
NCBI-GeneID: 4340738
NCBI-ProteinID: XP_015644494
UniProt: A0A0P0WVF0 Q5VN14
LinkDB
Position
6:complement(9256958..9262246)
AA seq 180 aa
MGFIGDTIESIRSMQVRQVLAQIISLGMIVTSALIIWKGLIVVTGSESPVVVVLSGSMEP
GFKRGDILFLHMSKDPIRTGEIVVFNVDGREIPIVHRVIKVHERQESAEVDILTKGDNNF
GDDRLLYAHGQLWLQQHHIMGRAVGFLPYVGWVTIIMTEKPIIKYLLIGALGLLVITSKE
NT seq 543 nt   +upstreamnt  +downstreamnt
atggggttcatcggcgacacgatagagtcaatccgctcgatgcaggtccgccaggtgctg
gcgcaaatcatcagcttaggtatgattgttacctctgcattgatcatatggaagggttta
atagttgtaacaggtagtgaatctccagtggtggtggttctttctggtagcatggaacct
ggatttaaaagaggtgacatcctgtttttgcacatgagcaaagaccctatccgcactgga
gaaatagttgtttttaatgttgatggccgtgaaattccaattgttcaccgtgtgatcaag
gttcatgaacgccaggagagtgcagaagttgacatcctcacaaaaggtgataacaatttt
ggggatgaccgacttctgtatgcacatgggcagctttggcttcagcaacatcatattatg
gggcgagctgttggttttctgccatatgttggatgggttacaattatcatgactgagaag
ccaattattaagtaccttctgatcggcgcgctgggcctactggttataacatcaaaggag
taa

DBGET integrated database retrieval system