KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280671
Entry
107280671         CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit-like
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2
Other DBs
NCBI-GeneID: 107280671
NCBI-ProteinID: XP_015634947
LinkDB
Position
4:complement(30499106..30501605)
AA seq 408 aa
MIKLNKRTCIIEAKDQPMDFPKYTFDLVSFDKLHDFTSKTDRFLDVIGKIIAVSNAAMIS
TSSSDYRMRRIVKLQDLSGKTIDLSLSGKRAVEFDGETILEVGQNNHIIAIFVGTSMKIL
KGTYEFLSGTTACRWYINENDIPEIKMFQKCLPPHADPIQKLYLQSDEDMQRSIEHKTLA
ELKEIDPFVDKDEKYQCTATIIGIQERKTWCYQACKLCNCKMIWDGSILKCKKENCPCRQ
YEYKYKIPFIANDGTASLELVLFEKKGTELIGRTAETMKRQYDINQTPPEIKAWIGHKFT
FIVKVLPNITINADEPSFEVLTIKERFGRQHSSQGFKATKNLPISSSSSQQLHNLPPLVP
ILSKKIQHEIEPPQDIQSMEVEPYNLETSTLSGKRAYEDPNSTDQVNN
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgatcaaactaaacaaaagaacttgtatcattgaagccaaagatcaacctatggatttt
ccaaagtatacatttgacttggtgtcatttgataaacttcacgatttcacaagcaagact
gatcgttttctagatgttattggaaaaatcattgctgtttctaatgcagcaatgatttct
acaagttcatcagattataggatgagaagaatagtcaaactacaagatttaagtggaaaa
accatcgacctctcattatcaggaaaaagagctgttgagtttgatggagagacaatactg
gaagttggtcaaaataaccatataatagcaatatttgttggtacatcaatgaaaatcctt
aagggaacatatgaatttctaagtggaacaacagcttgtcgttggtatatcaacgaaaat
gacatccctgaaatcaagatgtttcagaaatgccttccaccacatgctgatcctatacaa
aagctatacttgcaaagtgatgaagatatgcaacggagcattgaacacaaaacacttgca
gaattgaaggaaattgatccttttgttgacaaggatgaaaaataccagtgcactgctact
atcattggaattcaggaaagaaaaacttggtgttatcaagcctgtaaattgtgcaattgc
aagatgatatgggatggttctatattaaaatgcaagaaagagaactgcccatgtaggcag
tatgagtacaagtacaaaataccattcattgcaaatgatggcacagctagccttgaactt
gtgctatttgaaaagaaaggtacagaacttattggtaggactgctgaaactatgaaaagg
caatatgatatcaatcaaacacctccagaaataaaagcatggataggacataaattcaca
ttcatagtgaaggttttgccgaacataactatcaacgctgatgaaccttcatttgaggtg
ctgacaattaaagaaagatttggaaggcaacattccagccaaggctttaaggcaactaag
aatcttcccatcagttcaagttcatctcaacaactacataatttacctccactggtgcct
atactatccaagaaaatacaacatgagatagaaccaccccaagatattcaaagcatggaa
gttgaaccatataatttagaaacaagcactttgtcaggaaaaagagcttatgaagatcca
aacagtacagatcaggtaaacaactga

DBGET integrated database retrieval system