KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107281758
Entry
107281758         CDS       T01015                                 
Name
(RefSeq) alanine--tRNA ligase-like
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107281758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    107281758
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    107281758
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     107281758
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   107281758
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    107281758
 Prokaryotic type
    107281758
SSDB
Motif
Pfam: tRNA-synt_2c MINDY_DUB DASH_Dad4
Other DBs
NCBI-GeneID: 107281758
NCBI-ProteinID: XP_015646702
LinkDB
Position
7:complement(8938122..8943885)
AA seq 563 aa
MARPRGAGDVSFESKAHTRCSPSTILAAKDSPLLFADAEMNQFMPVLLDTAAQGSQLGCP
GHACKSLRCIPVAVDDRHLTFTEVLGNWSFGDYFKEEAIGFAWELLTKVYELEVDRIFVT
YFGGDEKSGLAPDLESKHIWLKYLPSDKVLPLVNKGNFYQNGDTGPCGPCSQIYFDQIGH
HDVASLLNNDDPGCIEIWNLVFFQFNKEAGGILMPSSAKHVGTGLNFEQLTSILQKKKSK
FDTDILMPTIDSIRQCTGNEIQPYSGKFGPDDINEVDLAYRIVADHIRTSSFAIADGSQP
GIEIARNMLRRAIYFGHQNLKAKQRFLTILVSAFIESMSGDFPELLHNEKKIKDIIAEEE
ITFAKDKKKFKKKDSKRRKKEKNNTEQNVVVTRPPKVSYKTRTIDFFGRPTHIIHQHENG
PCGLIVICNVLLLRSEIGLFLNKTEVMEDDLLSRIISRLKRCRKMQFELHEGFQYSEFQH
KVLSVAKNLWREVCINVTFKSTDGFVFSPEYALFDYLEIPVFHGWLVDQLHFNAASCLMW
CLCFAARYLSRIIRRSNGTPQPI
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggcccgcccgcgtggtgcgggagacgtttctttcgagtcgaaggcgcacacccggtgt
tccccgagcaccatcctcgccgcaaaggattcccctctacttttcgccgacgccgagatg
aatcagttcatgccggtgctcctcgacaccgctgcacaaggctcgcagctcggatgcccg
ggacacgcctgcaaatctctccgctgtatccccgtcgccgtcgatgataggcacctcacc
ttcaccgaggttctggggaactggtcctttggggactacttcaaggaggaggcaattgga
tttgcgtgggagctcttgactaaggtctacgaattggaggttgatagaatttttgtgaca
tatttcggaggtgatgagaaatcgggcttagcccctgatctggagtcaaaacacatatgg
cttaaatatctaccatcagataaagttctacctcttgtcaacaagggtaacttctaccaa
aatggtgacactggtccttgtggaccgtgcagtcaaatatattttgatcagattggtcat
catgatgttgcttcattattgaacaatgatgaccctggttgtattgagatatggaatctt
gttttttttcagttcaataaggaagcaggtggcatattgatgccatcatcagccaaacat
gtaggcactggactgaacttcgaacaattaacttctatacttcagaagaaaaagagcaaa
tttgacaccgacatattaatgccgacaattgactccatccgccaatgtactggcaatgaa
attcaaccatactctggtaaatttggtcctgatgatattaatgaagttgatttggcatac
cggatagttgcagatcacataagaacaagtagttttgctattgccgatggttctcagcct
ggaattgagatagcaaggaatatgcttaggcgggctatttacttcggtcatcaaaacttg
aaggccaagcaacgatttcttacaatccttgtaagtgcatttatcgaatcaatgagtgga
gactttcctgagcttttacacaatgaaaagaagataaaagatataattgcagaggaagaa
atcacttttgcaaaggacaagaagaaatttaaaaagaaagacagcaaaaggcggaagaag
gagaagaataacactgaacaaaatgttgtggtgaccagacctccgaaggtgtcctacaag
actaggacaattgatttctttggtcgtcccactcacattattcaccagcatgagaatggg
ccatgcggtcttatcgtgatctgcaatgttcttctcctaaggagtgagattggattgttc
ctaaacaaaactgaagtgatggaggatgatcttcttagtcgtatcatttctcgccttaaa
agatgcagaaagatgcagtttgagttgcatgagggttttcagtactcagaattccaacat
aaagttttatctgtagcaaaaaacctctggagagaagtatgcataaatgtgacttttaaa
agtactgatggctttgtgttctcacctgaatatgcactttttgattatcttgaaatccct
gtattccatgggtggcttgtggatcagttgcacttcaatgcagcatcatgcttaatgtgg
tgtctttgctttgctgcacggtacctttctcgcattatcagacgcagtaatggaacacct
cagcccatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348211
Entry
4348211           CDS       T01015                                 
Name
(RefSeq) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4348211
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4348211
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4348211
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     4348211
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4348211
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4348211
 Prokaryotic type
    4348211
SSDB
Motif
Pfam: tRNA-synt_2c tRNA_SAD DHHA1
Other DBs
NCBI-GeneID: 4348211
NCBI-ProteinID: XP_015614450
UniProt: Q10A14 Q0IYP7
LinkDB
Position
10:5632458..5643050
AA seq 999 aa
MLVVRRACCLLRLSSSSHPPATRVLPAAIYLTSSSSAAASAPAPPAMAASTEWPASRVRE
TFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDAPLGRLRRACNT
QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGFAWELLTQVYKLPTDR
IYATYFGGDEKFGLAPDTESKNIWLKYLPKEKVLPFGCKDNFWEMGDTGPCGPCTEIHFD
RVGNRDAASLVNNDDPTCIEIWNLVFIQFNREADCTLRPLPAKHVDTGMGFERLTSILQN
KMSNYDTDVFMPIFDAIHQLAGNGIQSYSGKVGPEDVDKVDMAYRVVADHIRTLSFAIAD
GSQPGNEGREYVLRRILRRAVHFGHQKLKAKQGFFSSLVHVFVQLMGDVFPELKDNEKKI
KDIIKDEEESFENTLAKGFEKFKKAADAVKESGGTVLSGQDAFVLWDTYGYPVDLTEVMG
VDYGLSVDREGFDAAMEEARQKARNARFKAGENSIVLDANATAQLRNQGLASTDDSPKYG
YKDNDSVVKAIYTGSEYVSAASGDEDFGLVLESTSFYAEQGGQIYDTGKIEGSFGSFNVT
NVQVFAGYVLHMGSFTKGSKALSVGDKVACKVDYARRALIAPNHTCTHMLNFALREILGD
HVDQKGSIVLPEKLRFDFSHGKPVQPEDLRKIESIVNQQIKDKLEVFAREIKLADAKRIN
GLRAVFGEIYPDPVRVVSVGRKVEDLLANPESKEWLSISTELCGGTHIKNTSEAEAFALL
SEEGIAKGVRRITAVTAKHASDAIKDASSIDSEINEASKLEGAILEKTIASIKSKLDTAL
IPAARKADLKGRVSKLEDELRKAKKKMGEENIQKAVKFAIDAAQTALSEGKRFCVAHVDV
GLDTSAIREAVIKVKDQKDLPIMLFSTDEATNKAVIYAGVPPSAANSLKVLDWLTPSIAP
LKGKGGGGKNGIAQGQGTEASQLKEAMEVATQIASMKLV
NT seq 3000 nt   +upstreamnt  +downstreamnt
atgctcgtggtacgccgcgcgtgctgcctcctccggctctcctcctcctcccacccgccc
gcgactagggttttgcccgccgccatctacctcacctcctcctcctccgccgccgcatcc
gcccccgcgccaccggcgatggcggcctcgacggagtggccggcgagccgagtgcgggag
accttcatctccttcttcgagtccaagtcccacacgcggtggccgtccagccccgtcgtc
cccgtcgacgaccccacgctgctgttcgccaacgccgggatgaaccagttcaagccggtc
ttcctcggcaccgccgccccggacgcgccgctgggccgcctccgccgcgcctgcaacacc
cagaagtgcatccgcgccggggggaagcacaacgacctcgacgacgtcgggaaggacacc
taccaccacaccttcttcgagatgctcgggaactggtccttcggggactacttcaaggag
gaggccatcggatttgcctgggagctcctcacccaggtgtacaaattgcctaccgataga
atttatgcgacttactttggtggtgatgagaaatttggacttgctcctgatacggagtcg
aagaacatatggttgaaatacctacccaaagaaaaagttctacctttcggttgcaaggat
aatttctgggagatgggtgatactggtccttgtgggccatgtactgaaattcattttgat
cgtgttggcaaccgtgatgctgcttccctagtgaacaatgatgaccccacttgtattgag
atatggaatcttgtgttcattcagttcaatagggaagcagattgtactctgagaccttta
ccagcaaaacatgttgacacaggaatgggatttgaacgcttaacttctatccttcagaat
aaaatgagcaattatgacacagatgtattcatgccaatatttgatgccatccaccaattg
gctggcaatggaattcaatcatactcgggtaaagtaggtcctgaagatgttgacaaagtt
gatatggcttacagagtagttgcagatcacataagaaccctttcgtttgctattgctgat
ggttctcaacctggaaatgagggcagagaatatgttctgaggcgtattcttaggcgcgct
gttcactttggtcatcaaaagttgaaagcaaagcaaggattttttagctctcttgtacat
gtatttgtccaactgatgggagatgtattccctgagctgaaggacaatgaaaagaagatc
aaagatataattaaagatgaagaggaaagctttgagaacactctagcaaagggttttgaa
aaatttaagaaagcggcagatgctgttaaagagagtggaggaacagtacttagtggacag
gatgcatttgtcctgtgggacacctatggctatccagttgacctgactgaggtcatggga
gttgactatggcttgagtgtggatcgggagggttttgatgctgcaatggaagaagcgagg
cagaaggctaggaatgcacgcttcaaggctggggaaaattccattgtcttggatgccaat
gctacagcacagctgcgcaaccaagggcttgctagtacagatgatagcccgaagtatggt
tataaggacaatgacagtgtggtgaaggctatctacactggttcagaatatgtaagtgcc
gcatctggcgatgaggactttggccttgtcctggaaagtacaagcttctacgctgaacag
ggtggtcagatatatgacactgggaaaattgaagggtctttcggatctttcaatgtaact
aatgttcaagtatttgctgggtatgtgctgcatatgggctcatttacaaaaggttccaag
gcattgtctgttggtgataaagtggcatgcaaggttgattatgctcgccgtgctctcatt
gctccaaaccatacatgtacccatatgctgaactttgctctacgggaaatacttggtgat
catgttgaccagaaaggttcaattgttctcccagagaagctacggtttgatttctcccat
gggaaacctgttcagccagaagatttgcggaaaattgagtctatagtgaatcaacagata
aaagacaaactggaagtatttgcacgtgaaataaaattagcagatgcgaagcgcataaat
ggtctacgagctgtgtttggtgaaatctatcctgatccggtaagagttgtatcagttggt
cgcaaagtggaagatctacttgccaatcctgaaagcaaagaatggctatccatttcaaca
gagctgtgtggcggtacacacattaaaaacactagcgaggcagaagcatttgccctgttg
tccgaggagggtattgctaaaggtgttaggaggatcacagctgttactgctaaacatgcc
tctgatgctataaaggatgcatcatctattgattctgaaatcaatgaagcatcaaaattg
gagggagctatattggaaaagacgattgcttccatcaagagcaagcttgatacagcttta
attccagctgcaagaaaagctgatcttaaaggccgggtgtcgaagttggaggatgaactt
aggaaggccaagaagaaaatgggcgaggagaacatccagaaggccgtgaagtttgcaata
gatgccgcccaaactgctctttctgaaggaaagcgcttctgtgttgctcatgtagatgtg
ggtcttgacacaagtgctattcgggaagcagttatcaaagtcaaggaccagaaggatttg
ccaatcatgctattcagcacggatgaagccacgaataaggcagtcatttatgctggtgtg
cctcccagcgctgctaacagcttgaaggtgttggattggttgacaccatcgattgcgccc
ctcaaaggaaagggaggtggtggcaagaatggaattgcccagggccagggaactgaggcc
tctcaactaaaggaagctatggaggttgctacccagatagcttcaatgaagctggtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266147
Entry
9266147           CDS       T01015                                 
Name
(RefSeq) alanine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    9266147
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9266147
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    9266147
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     9266147
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   9266147
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    9266147
 Prokaryotic type
    9266147
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Baculo_PEP_C
Other DBs
NCBI-GeneID: 9266147
NCBI-ProteinID: XP_015644249
UniProt: B9FSH5
LinkDB
Position
6:7574885..7581526
AA seq 996 aa
MEAAALLSPTATSRSPLPLLSTAPAAHRLHVLLPLSGRRRRLCLRSSPRPRGSLGCAGDC
VVRSMGSSRERGVLVKTSSSSASVESATQEVGAASSGEWSGDAIRRRFLDFYAARGHKIL
PSSSLVPDDPTVFLTIAGMLQFKPIFLGKEPRRVPCATTSQKCIRTNDIENVGRTSRHQT
FFEMLGNFSFGDYFKKEAITWAWELTTKEFGLPPERLWISVFQDDDEAFSIWHNEVGVPK
ERIKRLGEDDNFWTSGATGPCGPCSEIYYDFYPERGSSDADLGDDSRFIEFYNLVFMQYN
KKDDGSLEPLKQKNIDTGMGLERMARILQKVPNNYETDLIFPIIEKAASMALVSYTTADD
AMKTNLKIIGDHMRAVVYLISDGVIPSNIGRGYVVRRLIRRVVRTGRLIGIRGDGHGNSE
GAFLPSLAEVAISLSTEIDPDVESRRKSILGELQREELRFVQTLERGEKLLDELLDEALS
SAGNNGGKPCLSGKDVFLLYDTYGFPVEITAEISGERGVIVDMKGFDMEMENQRKQSQAA
HNVVKLSVGNETEIVKSIPDTEFLGYDSLSATAVVKGLLVNGNSVNVVSEGSDVEIFLDR
TPFYAESGGQVGDNGFLYVYGEEDAKQKAVIEINDVQKSLGNIFVHKGTIKQGSVEVGKE
IDAAVDAKLRQGAKAHHTATHLLQSALKSIIGSETSQAGSLVAFDRLRFDFNFHRPLSEE
ELMKIESLVNQWVSSATHLETKVMDLQDAKNAGAIAMFGEKYGEQVRVVEVPGVSMELCG
GTHVSNTAEIRGFKIISEQGIASGVRRIEAVAGDAFVEYVCARDNYMRCLCSSLKVKAED
VNGRVETILEELRTTRNEVSSLRSKIAVLKAASLANKATTIDNTRVVVENMGDVDADGLK
SAAEYLVDTLEDPAAVILGSSPGDGKVSLVAAFSPGVVKMGIQAGKFVGGIAKLCGGGGG
GKPNFAQAGGRKPENLPGALEKARDEIVAAISSKSS
NT seq 2991 nt   +upstreamnt  +downstreamnt
atggaggcggccgcactcctatcccccaccgccacctctcgctcccctctccccctcctc
tccaccgcgcccgccgcccaccgcctccacgttctcctgcctctctccggccgccgccgc
cgcctgtgcctccgctcctctcctcgaccccgcgggtcgttgggctgtgcgggagattgc
gtcgtgaggagtatgggttcgtctcgtgagcgcggggtgctcgtgaagaccagcagctca
tcagcctcagtcgaatcggcaacccaggaggtgggcgcagcgagttcgggggagtggagc
ggggacgccatacgccgacgtttccttgatttctatgctgcccgtggccacaagatcctt
cctagctcgtcgcttgtgccagatgaccccaccgtgttcctcactatcgccgggatgctt
cagttcaagcctatattccttggcaaggaacctaggcgtgtaccgtgtgctactacctcc
cagaaatgcatacggacaaatgacattgaaaatgtggggcgtacgagccggcatcaaacc
ttctttgagatgcttgggaacttcagctttggtgattacttcaagaaggaagcaatcaca
tgggcatgggagctaacaaccaaggagtttgggttacccccagaaagactatggattagt
gtatttcaagatgatgatgaagcattttccatttggcacaatgaggttggagtaccaaag
gagcgaataaagagattgggcgaggatgataacttttggactagtggtgcaactggaccc
tgtggcccatgttctgaaatttactatgatttctatcctgagagaggatcctcagatgcg
gatttgggtgatgatagtcgattcatcgaattctacaatcttgtcttcatgcaatacaac
aaaaaggatgacggatctcttgaaccattgaaacaaaagaacattgatacagggatgggc
cttgagcgtatggcacgtattcttcaaaaggttccaaacaactatgagacagacttgatt
ttcccaattattgaaaaggcagcaagcatggcattagtgtcgtacaccacagctgatgat
gctatgaagacaaatcttaaaataattggggatcacatgagagcagttgtttatctcata
tcagatggagtcattccctcaaatattgggagaggatatgttgtccgaaggcttataaga
agagtagttcgaactggtagactgataggtataagaggtgatgggcatggaaattcagaa
ggtgcctttttaccttcactagctgaggtagcaatcagtcttagcactgagatagatccg
gatgttgaatctagaaggaaatcaattcttggagaacttcaaagggaagaactgcgattt
gtgcagactttggaaagaggtgaaaaattattggacgaacttctggatgaggcattatca
agtgctggtaataatggtggtaaaccttgtctatctggaaaagatgttttccttttgtat
gatacatatggttttccagtagagattacagctgaaatatcaggtgaacgaggtgtaatt
gttgacatgaagggatttgatatggaaatggaaaaccaaaggaaacaatctcaggctgct
cataatgtagttaaactttctgtaggaaatgagactgagattgtcaagagtatccccgat
actgaatttctggggtacgactctctttctgccactgctgttgttaaaggtcttttagtt
aatggaaactcagtgaatgtagtttcagaaggttctgatgtagaaatatttttagatcgg
acaccattttatgctgaatcaggtggtcaagtgggagataatggtttcttgtatgtctat
ggagaagaagatgcaaaacagaaggcagtcatagaaatcaatgacgtccaaaaatccctg
gggaatatctttgttcacaaaggcacaattaaacaggggtccgtagaagttgggaaggaa
atcgatgctgctgttgatgcaaaattgaggcagggggctaaggcccatcatactgcaaca
catctcctacaatctgctcttaaaagtatcattggttcagaaacatcacaggcaggatcc
cttgtggcatttgaccgtctccgatttgacttcaatttccaccgccccctttctgaagag
gaattgatgaaaattgaatcacttgtaaaccaatgggttagcagtgctactcatcttgag
acaaaagtgatggatctgcaagatgcaaaaaatgctggtgcaattgcaatgtttggagag
aaatatggcgagcaggtcagagttgtagaggtccctggggtgtctatggaactctgtggt
ggaactcatgtgagtaacaccgctgagatccgtggtttcaagattatctcagagcaggga
atagcttctggagtcagaaggattgaggctgttgcaggtgatgcatttgttgagtatgtt
tgtgcccgtgacaactatatgcggtgcttgtgctcatcccttaaggtcaaggctgaagat
gtgaatggcagagtagaaacaattcttgaagagctaagaacaaccagaaacgaagtatca
tctctacgcagcaaaatcgcggtgctcaaagcagcatccctcgcaaataaagctacaact
atcgataacacgagggtcgtggttgagaacatgggtgatgtggacgccgatggtctgaag
agcgccgcggagtatctcgtggacacccttgaagaccctgccgcggtgatcttaggctca
agcccgggcgatggcaaggtcagcttggttgcggccttcagccccggcgtcgtcaagatg
ggtatccaggcagggaagttcgtcggcggcatagccaaactctgcggcggaggcggcggc
ggcaagcccaattttgcccaagccggtggacggaagccggagaacttgccgggtgcgctc
gagaaggcacgggatgaaattgttgctgctatatcgtcgaagtcgagctga

DBGET integrated database retrieval system