KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131385
Entry
3131385           CDS       T01015                                 
Symbol
rps12, OrsajCp102
Name
(RefSeq) ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131385 (rps12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131385 (rps12)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    3131385 (rps12)
  Bacteria
    3131385 (rps12)
  Archaea
    3131385 (rps12)
SSDB
Motif
Pfam: Ribosom_S12_S23 Ribosomal_S12
Other DBs
NCBI-GeneID: 3131385
NCBI-ProteinID: NP_039457
UniProt: P12149 A0A0K0LQN2
LinkDB
Position
Pltd:67390..126645
AA seq 124 aa
MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSG
FEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGALDAVAVKNRQQGRSKYGVK
KPKK
NT seq 375 nt   +upstreamnt  +downstreamnt
atgccaacggttaaacaacttattagaaacgcaagacagccaatacgaaatgctagaaaa
tcggccgcgcttaagggatgtcctcagcgtcgaggaacatgtgctagggtgtatactatc
aaccccaaaaaacccaactctgccttacgtaaagttgccagagtacgattaacctctgga
tttgaaatcactgcttatatacctggtattggccataatttacaagaacattctgtagta
ttagtaagaggaggaagggttaaggatttacccggtgtgagatatcgcattattcgagga
gccctagatgctgtcgcagtaaagaatcgtcaacaagggcgttctaaatatggggtcaaa
aagccaaaaaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131499
Entry
3131499           CDS       T01015                                 
Symbol
rps12, OrsajCp001
Name
(RefSeq) ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131499 (rps12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131499 (rps12)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    3131499 (rps12)
  Bacteria
    3131499 (rps12)
  Archaea
    3131499 (rps12)
SSDB
Motif
Pfam: Ribosom_S12_S23 Ribosomal_S12
Other DBs
NCBI-GeneID: 3131499
NCBI-ProteinID: NP_039359
UniProt: P12149 A0A0K0LQN2
LinkDB
Position
Pltd:complement(88473..67503)
AA seq 124 aa
MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTSG
FEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGALDAVAVKNRQQGRSKYGVK
KPKK
NT seq 375 nt   +upstreamnt  +downstreamnt
atgccaacggttaaacaacttattagaaacgcaagacagccaatacgaaatgctagaaaa
tcggccgcgcttaagggatgtcctcagcgtcgaggaacatgtgctagggtgtatactatc
aaccccaaaaaacccaactctgccttacgtaaagttgccagagtacgattaacctctgga
tttgaaatcactgcttatatacctggtattggccataatttacaagaacattctgtagta
ttagtaagaggaggaagggttaaggatttacccggtgtgagatatcgcattattcgagga
gccctagatgctgtcgcagtaaagaatcgtcaacaagggcgttctaaatatggggtcaaa
aagccaaaaaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 6450201
Entry
6450201           CDS       T01015                                 
Symbol
rps12, OrsajM_p21
Name
(RefSeq) ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6450201 (rps12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    6450201 (rps12)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    6450201 (rps12)
  Bacteria
    6450201 (rps12)
  Archaea
    6450201 (rps12)
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-GeneID: 6450201
NCBI-ProteinID: YP_002000567
UniProt: P28520 Q7JAI8
LinkDB
Position
MT:175914..176291
AA seq 125 aa
MPTKNQLIRHGREEKQRTDRTRASDQCPQKQGVCLRVSTRTPKKPNSALRKIAKVRLSNR
HDIFAHIPGEGHNSQEHSIVLVRGGRVKDSPGVKSHRIRGVKDLLGIPDRRKGRSKYGAE
RPKSK
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcctacaaaaaatcaattgattcgtcatggtagagaagaaaaacagcgcacggaccgt
actcgagcttcggatcaatgtccccaaaagcaaggagtatgcctgcgtgtttcgacgaga
acaccgaaaaaacctaattcagctctacgtaagatagcaaaagtacggttgagcaatcga
catgatatatttgctcacattccaggcgaaggtcataattcgcaggaacattctatagtc
ttagtcagaggaggtagagtgaaagattcgccaggtgtgaaatcccatcgtattcgagga
gtcaaggatttactgggaattccggatcgtagaaagggaagatctaaatatggtgcagaa
agaccaaaatcgaaatga

DBGET integrated database retrieval system