KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131391
Entry
3131391           CDS       T01015                                 
Symbol
atpF, OrsajCp021
Name
(RefSeq) ATP synthase CF0 B subunit
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    3131391 (atpF)
   00195 Photosynthesis
    3131391 (atpF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    3131391 (atpF)
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   3131391 (atpF)
SSDB
Motif
Pfam: ATP-synt_B SUIM_assoc
Other DBs
NCBI-GeneID: 3131391
NCBI-ProteinID: NP_039379
UniProt: P0C2Z0
LinkDB
Position
Pltd:32741..34111
AA seq 180 aa
MKNVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIYFGKGVLKDLLDNRKQRI
LSTIRNSEELRRGTIEQLEKARIRLQKVELEADEYRMNGYSEIEREKANLINATSISLEQ
LEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANISILGAME
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaaaaatgtaacccattctttcgtttttttagctcactggccatccgctgggagtttc
gggcttaataccgatattttagcaacaaatctaataaatctaactgtagtggttggtgta
ttgatttattttggaaagggagtgttaaaagatttattagataatcgaaaacagaggatc
ttgagtactattcgaaattcggaagaattgcgtagaggaaccattgagcagctcgaaaaa
gctcgaattcgattacagaaagtcgaactagaagcggatgagtatcgaatgaatggatac
tctgagatagaacgagaaaaagcaaatttgattaatgccacttctattagtttggaacaa
ttagaaaagtctaaaaacgaaaccctttattttgaaaaacaaagggcgatgaatcaggtc
cgacaacgggttttccaacaagccgtacaaggagctctaggaactctgaatagttgtttg
aataccgagttacatttccgtacgattcgtgctaatattagcattctcggggccatggaa
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332431
Entry
4332431           CDS       T01015                                 
Name
(RefSeq) ATP synthase subunit b', chloroplastic
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4332431
   00195 Photosynthesis
    4332431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4332431
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   4332431
SSDB
Motif
Pfam: ATP-synt_B Apolipoprotein Phasin CCDC90-like OmpH FapA Fib_alpha DUF4407 Baculo_PEP_C PIN_8 SASP FUT8_N_cat Peptidase_C98
Other DBs
NCBI-GeneID: 4332431
NCBI-ProteinID: XP_015630476
UniProt: Q84PA4 Q0DSZ4
LinkDB
Position
3:complement(9491491..9492489)
AA seq 211 aa
MATAMMAATATSCSPRRAPVVASSSVQPPRRQQQQQPRRGLKQLPGLVATAAVAVAAAPL
PALAEQMEKAALFDFNLTLPLIATEFLLLMVALDKLYFTPLGKFMDERDAKIRAELGGVK
DASEEVRQLEEQAAAVLKAARAEIAAALNKMKKETTQELEAKLDEGRRRVEAELVEALAN
LEAQKEEAVKALDAQIASLSDEIVKKVLPSA
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcgacggctatgatggctgcgaccgccacctcgtgctcccctcgccgcgcgccggtc
gtcgcgtcgtcgtccgtgcagccgcccaggcggcagcagcagcagcaaccgcggagggga
ttgaagcagctgccggggctcgtggcgacggcggccgtggccgtggccgcggcgccgcta
ccggcgctggcggagcagatggagaaggcggcgctgttcgacttcaacctgacgctcccg
ctgatcgcgaccgagttcctgctgctgatggtggcgctggacaagctctacttcacgccg
ctgggcaagttcatggacgagcgcgacgccaagatccgtgccgagctcggcggcgtcaag
gacgcgtccgaggaggtgcggcagctggaggagcaggccgccgccgtgctgaaggcggca
cgcgccgagatcgccgcggcgctcaacaagatgaagaaggagaccacccaggagctggag
gcgaagctggacgaggggcgccgccgcgtcgaggccgagctcgtggaggcgctcgccaac
ctcgaggcgcagaaggaggaggccgtcaaggcgctcgacgcccagatcgcctccctcagc
gacgagatcgtcaagaaggtgctcccatccgcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 6450152
Entry
6450152           CDS       T01015                                 
Symbol
orfB, OrsajM_p09
Name
(RefSeq) ORFB protein
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6450152 (orfB)
   00195 Photosynthesis
    6450152 (orfB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    6450152 (orfB)
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   6450152 (orfB)
SSDB
Motif
Pfam: YMF19_C YMF19 ATP-synt_8
Other DBs
NCBI-GeneID: 6450152
NCBI-ProteinID: YP_002000556
UniProt: Q8HCQ9
LinkDB
Position
MT:53424..53891
AA seq 155 aa
MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDP
KNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQI
LYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctc
tttagtttttatattctcttattaaataataataatggaatacttggaattagcagaatt
ctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccct
aagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactcc
agtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaa
atcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagatt
ctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaa
aaaataatgctcacacatgttccacacgggcaaggaagcataatctaa

DBGET integrated database retrieval system