KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131392
Entry
3131392           CDS       T01015                                 
Symbol
atpH, OrsajCp020
Name
(RefSeq) ATP synthase CF0 C subunit
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    3131392 (atpH)
   00195 Photosynthesis
    3131392 (atpH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    3131392 (atpH)
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   3131392 (atpH)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 3131392
NCBI-ProteinID: NP_039378
UniProt: P0C2Z9 P0C301 E9KIN6
LinkDB
Position
Pltd:32039..32284
AA seq 81 aa
MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM
EALTIYGLVVALALLFANPFV
NT seq 246 nt   +upstreamnt  +downstreamnt
atgaatccactaattgctgctgcttccgttattgctgctggattggccgtaggtcttgct
tctattgggcctggagttggtcaaggtactgctgcaggacaagctgtagaaggtattgcg
agacagccagaagcagaaggtaaaatacgcggtactttattgcttagtctagcttttatg
gaagctttaacaatttatggactagttgtggcactggcgcttttatttgcgaaccctttt
gtttaa

DBGET integrated database retrieval system