KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131393
Entry
3131393           CDS       T01015                                 
Symbol
atpI, OrsajCp019
Name
(RefSeq) ATP synthase CF0 A subunit
  KO
K02108  F-type H+-transporting ATPase subunit a
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    3131393 (atpI)
   00195 Photosynthesis
    3131393 (atpI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    3131393 (atpI)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    3131393 (atpI)
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   3131393 (atpI)
Chaperones and folding catalysts [BR:osa03110]
 Other chaperones and cochaperones
  PapD
   3131393 (atpI)
SSDB
Motif
Pfam: ATP-synt_A
Other DBs
NCBI-GeneID: 3131393
NCBI-ProteinID: NP_039377
UniProt: P0C2Y7 A0A0K0LQK7 Q7G7F2
LinkDB
Position
Pltd:30501..31244
AA seq 247 aa
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN
PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII
QLPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF
TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG
ESMEGHH
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaatattataccgtgttccattaaaacactcaaggggttatacgatatatcgggcgta
gaagtaggccaacacttctattggcaaataggaggtttccaaattcatgcccaagtactt
atcacttcttgggtcgtaattactatcttgctaggttcagttatcatagctgttcgcaat
ccacaaaccatcccaaccgatggtcagaatttcttcgaatatgtccttgagtttattcga
gacttaagcaaaactcagattggagaagaatacggtccctgggttccctttattggaact
atgttcctttttatttttgtttcgaactggtcgggtgctcttttaccttggaaaattata
cagttaccccatggagaattagcagcgcccacgaatgatataaatactactgttgcttta
gctttactcacgtcagcggcatatttttatgcgggtcttagcaaaaaaggattgagttat
ttcgagaaatatattaaaccaactccaatccttttaccaattaacatattagaagatttc
acaaaaccattatcgcttagttttcgacttttcgggaatatattggcggatgaattagtc
gttgttgttcttgtttctttagtccccttagtagttcctataccggtcatgtttcttgga
ttatttacaagcggtattcaagctcttatttttgcaacgttagccgcagcctatataggt
gaatccatggagggtcatcattga

DBGET integrated database retrieval system